[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55619.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 43->113 Y2599_MYCTU 2e-06 40.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55619.1 GT:GENE BAF55619.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2875921..2876334) GB:FROM 2875921 GB:TO 2876334 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55619.1 LENGTH 137 SQ:AASEQ MSSRNYRSIGFILLFLAVLCLFAAVFAKPAVGSQVSDRWPGNNGTHSCAGESGVVDEIVNMSTPTDRATDPATGDTYLRYSKNLIIISGEGTPECTITVEGLDRVNSGAFIWLGGGFGPSSPSSSSGGSSGSGGGVK GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 43->113|Y2599_MYCTU|2e-06|40.6|69/100| TM:NTM 1 TM:REGION 9->31| SEG 11->27|fillflavlclfaavfa| SEG 114->135|gggfgpsspssssggssgsggg| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,119-138| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccccEEEEEcccHHHHHHHHHccHHHHccccccccEEEEEcccEEEEcccccccEEEEEcccccccccEEEEEcccccccccccccccccccccccc //