[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55650.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->85 PF04066 * MrpF_PhaF 4.2e-11 24.0 50/55  
:BLT:SWISS 12->88 PHAF_RHIME 6e-09 32.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55650.1 GT:GENE BAF55650.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2919638..2919913 GB:FROM 2919638 GB:TO 2919913 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55650.1 LENGTH 91 SQ:AASEQ MDNTLYTAGLTIAAAFFMLSFIFTIYRIVVGPNSIDRLLGLDGTVSMIQCSMATYICWTLDTTVTNFMMVIALLGFISSVSVARFRKRDGA GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 12->88|PHAF_RHIME|6e-09|32.5|77/92| TM:NTM 2 TM:REGION 7->29| TM:REGION 51->73| HM:PFM:NREP 1 HM:PFM:REP 36->85|PF04066|4.2e-11|24.0|50/55|MrpF_PhaF| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -----1-1111---1------1----------11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,89-92| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //