[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55663.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  368/915 : Eukaryota  110/199 : Viruses  0/175   --->[See Alignment]
d.21.1
:280 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->276 1ym5A PDBj 7e-42 41.2 %
:RPS:PDB   6->276 3ednA PDBj 1e-43 22.0 %
:RPS:SCOP  5->276 1s7jA  d.21.1.2 * 3e-62 32.4 %
:HMM:SCOP  5->280 1s7jA_ d.21.1.2 * 2.7e-70 43.0 %
:RPS:PFM   12->275 PF02567 * PhzC-PhzF 1e-40 45.8 %
:HMM:PFM   12->272 PF02567 * PhzC-PhzF 5.6e-61 35.8 260/282  
:BLT:SWISS 8->276 YHI9_YEAST 2e-41 41.2 %
:PROS 76->86|PS00178|AA_TRNA_LIGASE_I

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55663.1 GT:GENE BAF55663.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2930424..2931266) GB:FROM 2930424 GB:TO 2931266 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55663.1 LENGTH 280 SQ:AASEQ MPSKISRPYYQVDVFSSEPFMGNPLAVIADADDLSAEQMARIARWTNLSETTFLLKPTQEGADYRVRIFTPTGELPFAGHPTLGTAHVFRELHGEQGTQLVQECVAGLVAVRAIDGPASGLAFQAPLTLKDGPLDASDLDAACEALGISPDFIRAHQWVDNGPGWAVVELPSAQHVLDLEPDFSAHPTLKLGVIGAYPEGAPHAFEVRAFAPGIGEDPVTGSLNASIAQWLHRDGRAGEGYLASQGTAIGRAGEICINVESDVIWVGGSVTTIFQGIAEF GT:EXON 1|1-280:0| BL:SWS:NREP 1 BL:SWS:REP 8->276|YHI9_YEAST|2e-41|41.2|262/294| PROS 76->86|PS00178|AA_TRNA_LIGASE_I|PDOC00161| BL:PDB:NREP 1 BL:PDB:REP 8->276|1ym5A|7e-42|41.2|262/294| RP:PDB:NREP 1 RP:PDB:REP 6->276|3ednA|1e-43|22.0|264/289| RP:PFM:NREP 1 RP:PFM:REP 12->275|PF02567|1e-40|45.8|262/274|PhzC-PhzF| HM:PFM:NREP 1 HM:PFM:REP 12->272|PF02567|5.6e-61|35.8|260/282|PhzC-PhzF| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02567|IPR003719| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02567|IPR003719| RP:SCP:NREP 1 RP:SCP:REP 5->276|1s7jA|3e-62|32.4|253/260|d.21.1.2| HM:SCP:REP 5->280|1s7jA_|2.7e-70|43.0|256/260|d.21.1.2|1/1|Diaminopimelate epimerase-like| OP:NHOMO 646 OP:NHOMOORG 489 OP:PATTERN ------------------------12211111-----------1------1---------1------- 11--21--111---1---------12-----1-111-21--1111-------11111---231-1-21221------------------------------3--11111-------------------------1--11-----3-11111111111----1-111-1111------------11111---1-1111111111111111-12211111----------1--12--------------------2------------------------1-1-------------------------------------------11112221223-1--111-----11-------11-----1----11--11-21111-------111---11---1111-111111-11111111111-33312222222321112111-----1111111111111--11-------------------------------11112111122331221111122111111114112211--1111111131111---1----2----------------------------------------1--------1------------------------1-1112--1-13---1------------1---------------11-111111111111-1111111111111--1--2121211121-111111111111111--1---11----------------------3222-12-2--------------1333232111-1-55551211111121112----------1--------1-1112222222331-------2----11------------------------------------11-1-------11 ------------111-1111121321-1111111111111111----111315111-1-112-11--11-111-121111111111-1----1-1-----1-1----1314--1-31-111-----121332-111-1--1-1----1-------111------21-----4214---------13111112--111-2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 278 STR:RPRED 99.3 SQ:SECSTR EHHHHEEEEEEEEEccEccTTcEEEEEEcccTTccHHHHHHHHHHHccccEEEEEccccTTccccEEEEEccccEcccHHHHHHHHHHHHHTTcccccEEEEEETTEEEEEEEcTTccEEEEEccccEEEEccccHHHHHHHTTccGGGccTTcccEEEEcccEEEEEEcccHcHHHHHcccGGGHHHHcEEEEEcccccTTccEEcEEccTcccEEcccHHHHHHHHHHHHHTccccEEEEEEEcGGGTccEEEEETccccEEEEEEcEEEEEEEEE## DISOP:02AL 1-4| PSIPRED ccccccEEEEEEEEEccccccccEEEEEEccccccHHHHHHHHHHcccccEEEEEEccccccEEEEEEEccccccccccHHHHHHHHHHHHHccccccEEEEEcccEEEEEEEEcccEEEEEEcccccccccccccHHHHHHHHHccccHHHcccEEEEEccccEEEEEEccHHHHHHccccHHHHHcccEEEEEEcccccccEEEEEEEccccccccccHHHHHHHHHHHHHccccccEEEEEEccccccccEEEEEEEccEEEEEcEEEEEEEEEEEc //