[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55676.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   67->123 PF04633 * Herpes_BMRF2 0.00065 27.8 54/349  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55676.1 GT:GENE BAF55676.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2946297..2946698) GB:FROM 2946297 GB:TO 2946698 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55676.1 LENGTH 133 SQ:AASEQ MLGTHRGSISWVSTILLAIGVILIGYAAVDFGPQLDSGGAAGWWALGIGAVFAVVSPYLYIIGISLRHTTTSEVVASVAIAVLFFISYLVWTTPVSGPVIFHPALINFGCAVLWLGITIFCAFRRDGREGIKI GT:EXON 1|1-133:0| TM:NTM 4 TM:REGION 7->29| TM:REGION 43->65| TM:REGION 70->92| TM:REGION 102->123| SEG 38->50|ggaagwwalgiga| HM:PFM:NREP 1 HM:PFM:REP 67->123|PF04633|0.00065|27.8|54/349|Herpes_BMRF2| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccEEEcHHHHHHHHHHHHHHHHHHHHHHcccEEcccc //