Corynebacterium glutamicum R (cglu2)
Gene : BAF55690.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55690.1 GT:GENE BAF55690.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2960435..2960836) GB:FROM 2960435 GB:TO 2960836 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55690.1 LENGTH 133 SQ:AASEQ MGKQEKLRIPLDIPGVESEEVGVELLAEGYYLVSSLPAVAQDCALGDVVRAHHVDEVLEFQEVAVAGGNKTLRVLVDAIAADHVRAQLETLGLYVEAPMSEMLTVNIAPDSPSHGLEILLDDLHAQGVIFRAL GT:EXON 1|1-133:0| SEG 15->29|gveseevgvellaeg| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-8| PSIPRED cccccEEEcccccccccHHHHHHEHccccEEEEEEcHHHHcccccccEEEEccHHHHHHHHHHHccccccEEEEEEEHHHHHHHHHHHHHHcEEEccccccEEEEEEccccccccHHHHHHHHHHccEEEEEc //