[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55726.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  227/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:334 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   88->334 2qpqB PDBj 1e-12 27.0 %
:RPS:PDB   50->334 2dvzA PDBj 1e-31 20.1 %
:RPS:SCOP  53->292 1us4A  c.94.1.1 * 6e-10 13.4 %
:HMM:SCOP  103->311 1hslA_ c.94.1.1 * 7e-05 21.6 %
:RPS:PFM   88->332 PF03401 * Bug 4e-32 36.5 %
:HMM:PFM   70->334 PF03401 * Bug 1.6e-34 25.7 261/274  
:BLT:SWISS 52->322 YFLP_BACSU 4e-24 24.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55726.1 GT:GENE BAF55726.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3000528..3001532) GB:FROM 3000528 GB:TO 3001532 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55726.1 LENGTH 334 SQ:AASEQ MAEVGAEPAGSAQSKTKQFVVGTAAVVITAIAAFFSVQSASGGEDIRSNMTLIAPAAAGGGWDTFQREQQQSMRVNKIVNNIQVVNIPGAGGTIALGKLSTMTAPNTLMVGGTGHIAAQIQFDTPAKIQDVTPIARVVEEFDIITVPADSPYNTLEELIEGWKADPAGVSWTGGGSFDQLVMTEIALSAGIDPKQTTFIPSDGGGEAIQALLNGTAKASTGGFADMYPQVEAGRLKVLGIAAEERLPGTEIPTLVEQGYDVTLTNWRAMFAPPGLSDEQIAELREIVAESIETPEWQSAVERNYWMSAPLEGEELDQFVEDEIDRIDQLFKEMG GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 52->322|YFLP_BACSU|4e-24|24.0|271/319| SEG 23->35|taavvitaiaaff| SEG 75->87|vnkivnniqvvni| BL:PDB:NREP 1 BL:PDB:REP 88->334|2qpqB|1e-12|27.0|241/291| RP:PDB:NREP 1 RP:PDB:REP 50->334|2dvzA|1e-31|20.1|274/292| RP:PFM:NREP 1 RP:PFM:REP 88->332|PF03401|4e-32|36.5|241/274|Bug| HM:PFM:NREP 1 HM:PFM:REP 70->334|PF03401|1.6e-34|25.7|261/274|Bug| GO:PFM:NREP 1 GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03401|IPR005064| RP:SCP:NREP 1 RP:SCP:REP 53->292|1us4A|6e-10|13.4|232/298|c.94.1.1| HM:SCP:REP 103->311|1hslA_|7e-05|21.6|185/238|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1412 OP:NHOMOORG 230 OP:PATTERN -------------------------------------------------------------------- --------111----------2---2------1222-112----1-------131-1-------212-111-----------2-----------------------------------------------------111--------------------------------------------41---11---11111111--111111312211111--113--------2--------------------------------------------------------------------------------------------2--------------------------1----55-------------1---------------H32--554654----------3-11111---E---12221142214321---6523-24311---------------------------------------------1-----C**f*-------------1---------9r***49---B5TUR*Pt2*x4A-----------------------12-1------1----------11-1----1--1-----1-----------------11--1-----1-1111----11---------------------1111------1-111-------111-1--1-11-112-----11111111111111111111------------------------------------386-----1--------1--------1-4-22221111111111111----------1-111111111111--1--------------1------------------------------------------------3------ -------------1------------------------------------------------------------------------------------------------------------------------------------------------B-----------------------------H---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 85.3 SQ:SECSTR #################################################EEEEEcccTTcHHHHHHHHHHHHHHHHTccEEEEccEEccGGGHHHHHHHHHccTccEEEEEcHHHHHTTccccTEEETTcEEEEEEEEEEcEEEEEcTTcccccHHHHHHHHHTcTTTcEEEEccTTcHHHHHHHHHHHTccTcEcEEEEcccHHHHHHHHHHTcccEEEEEHHGHHHHHHTTccEEEEEcccccGGGTTcccTTTTTcGGcccEEEEEEEETTcccHHHHHHHHHHHHHHTcHHHHHHHHHHTEEEccccHHHHHHHHHHHHHHHHHHHHcTT DISOP:02AL 1-17| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccEEEEEccHHHHHHccccccccHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHccccHHHEEEEccccHHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEEEcccccccccccccHHHHcccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHHHc //