[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55739.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  557/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
a.96.1
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->185 1lmzA PDBj 9e-49 53.4 %
:RPS:PDB   25->104 2dclB PDBj 2e-21 20.3 %
:RPS:SCOP  11->189 1lmzA  a.96.1.4 * 3e-58 50.3 %
:HMM:SCOP  11->191 1lmzA_ a.96.1.4 * 4.2e-66 51.4 %
:RPS:PFM   16->188 PF03352 * Adenine_glyco 4e-53 53.8 %
:HMM:PFM   16->189 PF03352 * Adenine_glyco 2.6e-71 52.3 174/179  
:BLT:SWISS 11->185 3MG1_ECOLI 1e-47 52.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55739.1 GT:GENE BAF55739.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 3014215..3014805 GB:FROM 3014215 GB:TO 3014805 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55739.1 LENGTH 196 SQ:AASEQ MNSLIVGEDGLSRPSWAAQDPLMRDYYDTEWGMPIRDEQGLFERISLEAFQSGLSWATILRKRDNFRAAFSQFDPELVAKFTDADIERLMEDAGIVRNKRKILATINNAKATLPLREKGGLVDFVWSFKPAKTPQPETLEEIPTQSPESVALSKALKKEGFSFVGPTTMFALMEAIGIIDTHLVGSHRRGSSGVWA GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 11->185|3MG1_ECOLI|1e-47|52.0|175/187| BL:PDB:NREP 1 BL:PDB:REP 11->185|1lmzA|9e-49|53.4|174/187| RP:PDB:NREP 1 RP:PDB:REP 25->104|2dclB|2e-21|20.3|74/98| RP:PFM:NREP 1 RP:PFM:REP 16->188|PF03352|4e-53|53.8|173/179|Adenine_glyco| HM:PFM:NREP 1 HM:PFM:REP 16->189|PF03352|2.6e-71|52.3|174/179|Adenine_glyco| GO:PFM:NREP 2 GO:PFM GO:0006284|"GO:base-excision repair"|PF03352|IPR005019| GO:PFM GO:0008725|"GO:DNA-3-methyladenine glycosylase I activity"|PF03352|IPR005019| RP:SCP:NREP 1 RP:SCP:REP 11->189|1lmzA|3e-58|50.3|179/187|a.96.1.4| HM:SCP:REP 11->191|1lmzA_|4.2e-66|51.4|181/187|a.96.1.4|1/1|DNA-glycosylase| OP:NHOMO 632 OP:NHOMOORG 569 OP:PATTERN ---------------------------------1---------------1-----------------1 --1-111222211111111-11111111111111111111111111-2-111111211--111-1121111-----11--11------1111-1--1--1-11111-1-1--------------1---------------------1-------------------------------------------11-----------------11----------11-11111111-11111111111111111111212-22-111133112221211111-11111111111111111111111111111111112111111111--1-1---1-11---1----------1-1----11--------111------111111111111111111111111111111-111-11111111111-11121111111111112111111111211111111-----111--------------------------------1--111121111112111111121111111111111--111-11111-1-1-11--1-11-1111111----11-2111-11-11111-1-11-11-11111--1--211--------1--------1-----1111111111-1111111111111111111------1------1111111111111-111-1111111111111111111111111111111111111111111111111111-111111111111---111111111111212111111-1111---11111111---11111111121111111111----1----111-11111111111111211111-------1----11----------1----1-------------------------------11 ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------256E-73------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 89.3 SQ:SECSTR ##########cccccHHHHHHHHHETTcEETTEEccccccHHHHHHHHHHHTTccccEEEEccccccccccccEEEEEEEEEHHHHHHHHcccEEEEEEEEEccHHHHHHHHHHHHHTTcHHHHHHHTccEEccccccTTTcccccHHHHHHHHHHHHHTcccccHHHHHHHHHHHTcEEcccTT########### DISOP:02AL 1-1| PSIPRED cccEEEccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccccc //