[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55748.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  615/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.22.1
:326 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   155->318 2nq2B PDBj 3e-11 26.4 %
:RPS:SCOP  2->321 1l7vA  f.22.1.1 * 9e-45 28.9 %
:HMM:SCOP  1->321 1l7vA_ f.22.1.1 * 9.6e-76 42.7 %
:RPS:PFM   9->320 PF01032 * FecCD 7e-40 39.7 %
:HMM:PFM   10->320 PF01032 * FecCD 3.5e-92 42.7 309/311  
:BLT:SWISS 1->321 YFIZ_BACSU 7e-38 38.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55748.1 GT:GENE BAF55748.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 3023201..3024181 GB:FROM 3023201 GB:TO 3024181 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55748.1 LENGTH 326 SQ:AASEQ MLIVLAVAILPLMALSLFIGSRIIAPSVVVEGLTHFDPTNNDHLVLRELRIPRTIIAVVAGAALGLAGTLMQSLTRNALAEPGTLGVNAGAAAGVVIGLTFFSTSSINIYIWFAFIGAGIASVLVHRLGRSGETGVNPVRLVLAGAGLSIMVSSITTMLVLSSTDKVFTALRAWATGSLDGRGWESLPAVALSLLACVILCAYLAGSLNSVTLGQDLATSLGVNIRRTWLLTNVGILILAGGATAAVGPIGFVGLAAPHIARTLAGPDHKWLLPYSAVIAGLVLLSADIIGRVIIFPAEIGAGIMTAFIGAPFFIWLVRRGKVSGL GT:EXON 1|1-326:0| BL:SWS:NREP 1 BL:SWS:REP 1->321|YFIZ_BACSU|7e-38|38.6|319/333| TM:NTM 8 TM:REGION 8->30| TM:REGION 48->70| TM:REGION 97->119| TM:REGION 139->161| TM:REGION 185->207| TM:REGION 234->256| TM:REGION 274->296| TM:REGION 299->320| SEG 54->70|tiiavvagaalglagtl| SEG 86->98|gvnagaaagvvig| SEG 234->248|vgililaggataavg| BL:PDB:NREP 1 BL:PDB:REP 155->318|2nq2B|3e-11|26.4|163/300| RP:PFM:NREP 1 RP:PFM:REP 9->320|PF01032|7e-40|39.7|310/313|FecCD| HM:PFM:NREP 1 HM:PFM:REP 10->320|PF01032|3.5e-92|42.7|309/311|FecCD| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01032|IPR000522| GO:PFM GO:0006810|"GO:transport"|PF01032|IPR000522| GO:PFM GO:0016020|"GO:membrane"|PF01032|IPR000522| RP:SCP:NREP 1 RP:SCP:REP 2->321|1l7vA|9e-45|28.9|308/324|f.22.1.1| HM:SCP:REP 1->321|1l7vA_|9.6e-76|42.7|309/324|f.22.1.1|1/1|ABC transporter involved in vitamin B12 uptake, BtuC| OP:NHOMO 2513 OP:NHOMOORG 659 OP:PATTERN --2----1-----------1-112222213211--111212111164854D81-2222342-11---- ----364599B6661------1---3----------4D45-4133231553-7311-42235-8C8437K6--------1221-----3221-222-----11111122----------------13122111223144221137-5-2222-11--------42-1451-------------3421122-168DDEDECDD7EDEEED99AAAAEEE576B755444444HF388888887888888433553-1----1---33-1--2-----1113333333111111111111112333333333333222---222223B4699998A95B6242227563512-421-2DB2--31212322215131----122122111--1344342433333333338-11-11121322-6887453576653112-239323332-11111111-221--11-------------------------------1--222222133233222221111222211411-1-2--111-1111512--2111-1-152---------1-11-65221122-311-----1---24111121341253-22222----------11---1135223111221122311121--21222322---112-------G578296688A699964-768488A4867A8666664AABAB6655455555555555555944855563-777777767777--2-----------195E332342--11-1--5--11-11-232124132425224221466---------17454565568693311---------------111------------4-1------------------------11121122222-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 54.9 SQ:SECSTR ###########################################################################################################################################HHHHHHHHHHHHHHHHHHHHHTccTTTHHHHHHHHHccccTTccHHHHHHHHHHHHHHHHHHHHTTTGGGGGGccHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHccccccTTTHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHH######## DISOP:02AL 324-327| PSIPRED cHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcHHHHHHHHHHHHHHHHHHHHHHHccc //