[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55761.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:1043 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   641->702 3bn6A PDBj 9e-06 19.7 %
:RPS:PFM   33->533 PF11847 * DUF3367 e-119 53.0 %
:HMM:PFM   32->684 PF11847 * DUF3367 1.2e-231 52.5 631/680  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55761.1 GT:GENE BAF55761.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 3036455..3039586 GB:FROM 3036455 GB:TO 3039586 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55761.1 LENGTH 1043 SQ:AASEQ MPCSVALSMVHAKQTKKPLPRFLHSAHFYVWIVLGFVVFAQPYGQVAADTKLDLLLNPAGFLTSALHAWTDTFTLGQLQNQAYGYLFPQGFFFLITDFLPDWIAQRLWWWLVLSLGFSGFYALVARLGIGNPAFRVIAALLFALSPRTLTTLTAISSETWPIMLAPWVCLPLLSRNVGARAIALSLLPAACMGAVNATATMAALIPAALILLYRGLFLRLLLWGMGVLAVNSWWIGPLLVLGKYAPPFTEFIESSSVTTSWLNPAEILRGTTSWTPFVDTERQAGYLLVNDALFVTLSVLVAALGLIGLTLMKHRGLWAFMLAIGLLILGSAHLTAVQEFLDGPGAALRNIHKFDLLVRMPLMVGVAALGSHISLPLLGTTALTSGQGKHHTIPLPLQKRQAAGLLVVIIAVGALAPAWSARLLPQGTWDEVPDYWYEATEFLNQNATGTRTLIWPSSPFARQDWGWTRDEPAQPLLDVPWAVRDAIPLVPPEAIRGLDGLDDLGTLGTGLNDEALKRLGIGAVLVRHDLEADPDIEVDLPGEKHTFGSQGQVDVYLIDPDRNMWITSGTSKQLPTVAGGGEILSLLDTINGYSPRTLVSENAQIVTDTPQLVGTNYGDGTSSAALANLEETEVKNRIVDYPSAGPMTQVVQEGSITASSSGSDATSFGGADPDRSLNSLLDHRYNTAWYPTPGDTSPWLEVSGTGTTLSISPRSTVTATITSGDSVMVREFEKGRTTTVTLAQPEARIEFDGFVGISELSLEGLSRTITVPETSPDVQQFVFQRLTVPTSFLDRTFTVPRHMSVTVDAQSCVTLELDGDRINCGPLELTPGTHTLRTQSEWVTLTESVPHASVQPATNIEAAPTDRVLVTTRAFNSGTSVLIDATPLSPIQLDASSQGFIIPANASGELSFAFDGEKPYKLSLFGGATIALIVVLGCVVVGRRREAINPVWQDTRNAQWAVVALIPMLGWWFVPAVASWLVLRFTLIPKWVLAGLPLAICGLWLAQAPWPAAAYPGDSPALALLAGISVAALFAGDLRPPKR GT:EXON 1|1-1043:0| TM:NTM 14 TM:REGION 20->42| TM:REGION 82->104| TM:REGION 108->130| TM:REGION 135->157| TM:REGION 164->186| TM:REGION 202->224| TM:REGION 287->309| TM:REGION 315->337| TM:REGION 357->379| TM:REGION 402->424| TM:REGION 921->942| TM:REGION 957->979| TM:REGION 984->1006| TM:REGION 1021->1038| SEG 197->228|atatmaalipaalillyrglflrlllwgmgvl| SEG 497->511|gldglddlgtlgtgl| SEG 934->945|vvlgcvvvgrrr| SEG 1003->1014|lwlaqapwpaaa| RP:PDB:NREP 1 RP:PDB:REP 641->702|3bn6A|9e-06|19.7|61/158| RP:PFM:NREP 1 RP:PFM:REP 33->533|PF11847|e-119|53.0|496/678|DUF3367| HM:PFM:NREP 1 HM:PFM:REP 32->684|PF11847|1.2e-231|52.5|631/680|DUF3367| OP:NHOMO 45 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- -----1111111-111111-11111111111111111111-222----------------111----1-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 5.8 SQ:SECSTR ################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################cEEcccTTccccGGGEEEcccccGGGcGGGcccGGGcc#TTcccccccEEcccccTTccEEE##################################################################################################################################################################################################################################################################################################################################################### DISOP:02AL 1-2,655-672,1041-1044| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccHHHcHHHHHHHHHHHHccccccccEEcEEEEEEccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccccccccccccccccccccccccccHHHHHccccccccccHHHHHHcccccccccccccccccEEcccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcEEccccccHHHccHHHHHHHHHHHHHccccEEEEEEcccccEEEcccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHcccEEEEEEcccccccccccccccccccccccccEEEEEEcccccccccccccccccEEccHHHHHHHHHHHcccccccccccccEEEccccEEEccccccccccHHHHHcccccccccccccccccHHHHHHHHccEEEEcccccccccccccccccHHHHHcccccccEEccccccccEEEEEEEccccEEEEcccEEEEEEcccEEEEEEccccccEEEEEccccEEEEEccccEEEEEEccccccEEEcccccccHHHHHHHHHccccccccccccccccEEEEEEcccEEEEEEccEEEEcccccccccEEEEEEEccEEEEEcccccEEEccccccccccccEEEEEEEccccccEEEEcccccccEEEEccccEEEEEcccccEEEEEEcccccEEEEEEcccHHHHHHHHHHHHEEccHHHccHHHcccccccEEEEEHHcccccccHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccccc //