[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55778.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  529/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:516 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->516 1xnwA PDBj e-129 46.0 %
:RPS:PDB   5->516 2a7sA PDBj 5e-69 46.8 %
:RPS:SCOP  5->245 1on3A1  c.14.1.4 * 9e-68 42.1 %
:RPS:SCOP  250->515 1on3A2  c.14.1.4 * 2e-68 38.9 %
:HMM:SCOP  2->248 1od2A2 c.14.1.4 * 7.1e-70 39.7 %
:HMM:SCOP  251->516 1od2A2 c.14.1.4 * 5.2e-86 38.2 %
:RPS:PFM   37->492 PF01039 * Carboxyl_trans 2e-93 43.2 %
:HMM:PFM   34->512 PF01039 * Carboxyl_trans 4.5e-150 42.9 478/493  
:HMM:PFM   3->51 PF02720 * DUF222 0.00064 34.7 49/164  
:BLT:SWISS 5->516 PCCB_MYCLE e-129 46.7 %
:TM
:REPEAT 2|44->183|287->416
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55778.1 GT:GENE BAF55778.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3055176..3056726) GB:FROM 3055176 GB:TO 3056726 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55778.1 LENGTH 516 SQ:AASEQ MSNTTTAEKLADLRARLEIAKDPGSERARKKRDEEGRTTPRQRIDALLDAGSFVEIGALGRTPDEPDAPYSDGVVTGYGRIDGRPVAIYAHDKTVYGGSVGMTFGRKVSEVMDMAIRIGCPVIGIQDSGGARIQDAVTSLAMYSEIARRQLPLSGRSPQISIMLGKSAGGAVYAPVTTDFVIGVDGETEMYVTGPAVIKEVTGEQITSADLGGGAQQMQNGNISYLASSEEEALNMVKDLLDFLPLTCNDPAPVFAAPTDEEIAYDEALNSFMPDDTNQGYDMHDLLDKLFDDANLLEIQEEYAPNLITTFARVDGKAVGVVANQPMDKAGCIDADAADKGARFIRICDAYNIPIIFVVDTPGYLPGVDQEKVGLIHRGAKLAFAVVESTVPKISLIVRKAYGGAYAVMGSKNLTGDLNFAWPTAQIAVMGAAAAVVMIQGKQLEAAPPEQREYMKKLFMDFYDENMTSPYVAAERGYIDAMIEPAETRLVLRRAVRQLETKAVRDLDKKHTIMPM GT:EXON 1|1-516:0| BL:SWS:NREP 1 BL:SWS:REP 5->516|PCCB_MYCLE|e-129|46.7|512/549| TM:NTM 2 TM:REGION 346->367| TM:REGION 423->445| NREPEAT 1 REPEAT 2|44->183|287->416| SEG 425->441|aqiavmgaaaavvmiqg| BL:PDB:NREP 1 BL:PDB:REP 5->516|1xnwA|e-129|46.0|511/521| RP:PDB:NREP 1 RP:PDB:REP 5->516|2a7sA|5e-69|46.8|509/529| RP:PFM:NREP 1 RP:PFM:REP 37->492|PF01039|2e-93|43.2|437/454|Carboxyl_trans| HM:PFM:NREP 2 HM:PFM:REP 34->512|PF01039|4.5e-150|42.9|478/493|Carboxyl_trans| HM:PFM:REP 3->51|PF02720|0.00064|34.7|49/164|DUF222| GO:PFM:NREP 1 GO:PFM GO:0016874|"GO:ligase activity"|PF01039|IPR000022| RP:SCP:NREP 2 RP:SCP:REP 5->245|1on3A1|9e-68|42.1|240/253|c.14.1.4| RP:SCP:REP 250->515|1on3A2|2e-68|38.9|262/264|c.14.1.4| HM:SCP:REP 2->248|1od2A2|7.1e-70|39.7|234/389|c.14.1.4|1/2|ClpP/crotonase| HM:SCP:REP 251->516|1od2A2|5.2e-86|38.2|262/389|c.14.1.4|2/2|ClpP/crotonase| OP:NHOMO 1610 OP:NHOMOORG 718 OP:PATTERN --1-1111111111111------132231-23----------------------1111111-----11 2354934544533277755-593378555555887876A826361223111122222211566234455531111111-11-3-----333313111--1222332232311111111111111--1122-2123-3556511131---111-11---------1--111-------------223221-113311111111111111132223211134342--------2--------------------------------------1----------------------------------------------------1211-----------21------2-1--2212-111111-111112112131-5335-----127442315655433333321232-22422321234-222221222322223322223333324--------1----2431111111111--11111111111111111-3422-132132222222111122232222-222457541133133323424448123----32--11111---2232943-----------3232212-244444421----------1-----------1111111-22-1132-1111111111112111111---1---------111-11--------------------------------1-112-1-1---------------1--------111111111111---1111112333-22-----1-----1-----333331-2112-55551533412122222---------1---2-----12-112222222111------11221122------------------------------------1111111111-21 ----222-721-225222232212213222211111222222222221111131111111111--------------------------1212211111-114444-2425343333222222-44231JJ2-334221222223222212224233354952532111132344222-----2211112112232223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 512 STR:RPRED 99.2 SQ:SECSTR ####cHHHHHHHHHHHHHHTTcTTcHHHHHHHHHTTcccHHHHHHHHccTTccEEEcTTccccccccccTTTTEEEEEEEccccEEEEEEEcTTcGGGcccHHHHHHHHHHHHHHHHHTccEEEEEccccccGGGcTHHHHHHHHHHHHHHHHTTTccEEEEEccccccGGGHHHHHccEEEEEcTTcccccccHHHHHHHHcccccHHHHHcHHHHHTcccccEEEccHHHHHHHHHHHHHHcccTccTTccccccccccccccGGGTTTTccccccccccTHHHHHHHHcccccEEEcTTccTTEEEEEEEccccEEEEEEEcTTTGGGcccHHHHHHHHHHHHHHHHTTccEEEEEEEccccccHHHHHHcHHHHHHHHHHHHHHccccEEEEEEEEEEHHHHHHTTcGGGTccEEEEcTTcEEEcccHHHHHHHHTTTTTTGGGTccccTcTTHHHHHHHTTTcccHHHHHHTcccEEccGGGHHHHHHHHHHHTTTccccccccccccccc DISOP:02AL 1-6,25-25,27-28,444-452| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHcccccEEccccccccccccccccccEEEEEEEEccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHccccEEEEEcccEEEEEcHHHHHHHHcccccHHHccHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHccccEEEccccccccEEEEEEEEEccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccEEEEccccccccEEEEccccEEEEccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccc //