[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55792.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   17->52 3cghA PDBj 4e-04 16.1 %
:HMM:PFM   28->87 PF12117 * DUF3580 0.00024 25.0 60/120  
:HMM:PFM   225->248 PF02466 * Tim17 0.00092 33.3 24/128  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55792.1 GT:GENE BAF55792.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3078185..3078964) GB:FROM 3078185 GB:TO 3078964 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55792.1 LENGTH 259 SQ:AASEQ MRVPPFVILAKWVLCTFCEDLSNELAKHNFGKVPPMTENWMDPVVEPQSTGEGKSDTIWLEIVTTDQNKRSLSELAARIVSEICAPWVLNIGFFLILGDVTGAWTLGIVAAIGTGIVPMILILGLMKLGRVGNHHVTTRNQRGLVFVGIIVCVIILIFILRALEAPQLIWDGMFSALIFLVLFAQVTLKIKASVHVGLWVCLVMFLGLTVSSWWLLGLLFTPVTAWARMRIKHHTMSEIVAGVVTGAVATGICYALLLA GT:EXON 1|1-259:0| TM:NTM 7 TM:REGION 1->23| TM:REGION 75->97| TM:REGION 107->129| TM:REGION 144->166| TM:REGION 168->189| TM:REGION 202->224| TM:REGION 236->258| SEG 143->160|glvfvgiivcviilifil| SEG 240->251|vagvvtgavatg| RP:PDB:NREP 1 RP:PDB:REP 17->52|3cghA|4e-04|16.1|31/498| HM:PFM:NREP 2 HM:PFM:REP 28->87|PF12117|0.00024|25.0|60/120|DUF3580| HM:PFM:REP 225->248|PF02466|0.00092|33.3|24/128|Tim17| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------1---------------------------------------------------------------------------------------1-1------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 31 STR:RPRED 12.0 SQ:SECSTR ################HHHHHHH#####HHcccccTTccTTcccccccccHH############################################################################################################################################################################################################### DISOP:02AL 1-1,48-52| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccccccEEEHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHEEEEEEEEHHHHHHHHHHHccHHHHHHHHHHHccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHc //