[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55824.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  245/915 : Eukaryota  16/199 : Viruses  2/175   --->[See Alignment]
c.1.18
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->257 2pz0B PDBj 3e-22 37.9 %
:RPS:PDB   22->255 3ch0A PDBj 6e-28 18.9 %
:RPS:SCOP  23->260 1zccA1  c.1.18.3 * 1e-31 22.7 %
:HMM:SCOP  20->258 1t8qA_ c.1.18.3 * 1.6e-45 35.6 %
:RPS:PFM   27->250 PF03009 * GDPD 5e-20 38.5 %
:HMM:PFM   27->251 PF03009 * GDPD 3.7e-29 29.7 222/255  
:BLT:SWISS 25->251 GLPQ_BACSU 3e-18 31.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55824.1 GT:GENE BAF55824.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3114542..3115366) GB:FROM 3114542 GB:TO 3115366 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55824.1 LENGTH 274 SQ:AASEQ MRNWEDTRVDSRYIKARRDGFMKVIAHRGLSSRFPELTESAFRAALELPIHGIETDVRLTKCGEVVNIHDPIVDRVSNGRGRVSRLDLESLLSLNFGTKEAPEKVLTLNNLLDILEDYPDKHLYIETKHPMRYAIMLEEEVTKILKYRGLMEDPRIHIISFALPAISRMERLAPAIDRIHLRRSWERWGNPRDLRCGAPTGLGLSVERAKMDPRMIGAKGLPTYLFTVDKQKDMLWARDHGVDMLATNYPDRAAELLNAHPKPAMYANAHGKED GT:EXON 1|1-274:0| BL:SWS:NREP 1 BL:SWS:REP 25->251|GLPQ_BACSU|3e-18|31.2|224/293| BL:PDB:NREP 1 BL:PDB:REP 24->257|2pz0B|3e-22|37.9|219/243| RP:PDB:NREP 1 RP:PDB:REP 22->255|3ch0A|6e-28|18.9|233/265| RP:PFM:NREP 1 RP:PFM:REP 27->250|PF03009|5e-20|38.5|213/241|GDPD| HM:PFM:NREP 1 HM:PFM:REP 27->251|PF03009|3.7e-29|29.7|222/255|GDPD| GO:PFM:NREP 2 GO:PFM GO:0006071|"GO:glycerol metabolic process"|PF03009|IPR004129| GO:PFM GO:0008889|"GO:glycerophosphodiester phosphodiesterase activity"|PF03009|IPR004129| RP:SCP:NREP 1 RP:SCP:REP 23->260|1zccA1|1e-31|22.7|225/240|c.1.18.3| HM:SCP:REP 20->258|1t8qA_|1.6e-45|35.6|239/0|c.1.18.3|1/1|PLC-like phosphodiesterases| OP:NHOMO 444 OP:NHOMOORG 273 OP:PATTERN ------1--------121----------------------------1-------11-111-------- --1-211111111111111-11111111111111111111------------11121---12111-1222------------2--1----1----------1------------------------------------------11---------------------------------------1----12244444444434444433255334432222222-1111-2434444343344443343444111-11--11122--11--1211211--------11---------------------------------1-2-112222222121-1--12211--1-2-1--------11--111--1--------11111---------------------------------1---1--111111-11------------1-------------------------------------------------------------------------------------1---------------------------------------2--1----------1-1----1-11-11----------------------------------------1----------------------------------11-------------------------------------1--1---------------------------111111-1111----111111111---1--------------------------1-22221---2---11122--------------1111121-11--------------------11----------1--------------------11------------------ ----11-------1-1--1-----------------------------------------------1-------------------1-------11311-11-------------1---------------------------------------------------------1------------------------- -------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 237 STR:RPRED 86.5 SQ:SECSTR ####################ccEEEETTTTTTTccTTcHHHHHHHHHHTccEEEEEEEEcTTccEEEcccccccTTTcETTEEccTTTGGGccGGGcHHHTccccccccccHHHHHHHHccEEEEEEcccGGGcTTTcccHHHHHHHHHTTcGGGEEEEEccHHHHHHHHHcTTcEEEEEEcccccHHHHHTTcccccTcEEEEcGGGccHHHHHHHHHTTEEcccccccHHHHHHHHHHTccEEEEccGGGGTcHH################# DISOP:02AL 1-13,262-275| PSIPRED ccHHHHcccccccccccccccEEEEEEcccccccccccHHHHHHHHHccccEEEEEEEEccccEEEEccccccccccccEEEEccccHHHHHHccccccccccccccHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHcccccEEEEEccHHccccHHHHHHcccEEEcccHHHHHHcHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEEccHHHHHHHHHHccccccccccccccc //