[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55849.1
DDBJ      :             hypothetical protein
Swiss-Prot:MSRA_CORGB   RecName: Full=Peptide methionine sulfoxide reductase msrA;         Short=Protein-methionine-S-oxide reductase;         EC=1.8.4.11;AltName: Full=Peptide-methionine (S)-S-oxide reductase;         Short=Peptide Met(O) reductase;

Homologs  Archaea  31/68 : Bacteria  781/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
d.58.28
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->213 1fvaB PDBj 1e-56 50.5 %
:RPS:PDB   48->213 3e0mC PDBj 2e-51 38.6 %
:RPS:SCOP  11->204 1ff3A  d.58.28.1 * 1e-64 49.5 %
:HMM:SCOP  5->217 1ff3A_ d.58.28.1 * 4e-64 42.9 %
:RPS:PFM   55->204 PF01625 * PMSR 4e-40 61.1 %
:HMM:PFM   49->206 PF01625 * PMSR 1.9e-53 48.4 153/156  
:BLT:SWISS 1->217 MSRA_CORGB e-133 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55849.1 GT:GENE BAF55849.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3143982..3144635) GB:FROM 3143982 GB:TO 3144635 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55849.1 LENGTH 217 SQ:AASEQ MAWFFAPEPVMVTADEALKGGRHPVLENPAPHTVLGTPVTGPWKEGQQRIWIGLGCFWGVEQMYWQMDGVEGTSVGYAGGFTPNPTYREVCSGRTGHTEIVEVVYDPSKISLEQLVARGLEAHDPTQGFRQGNDVGTQYRSAYYTENEEDAARVKAVVDAYGETLKQHGFGEITTEIGVISPSEYFLAEDYHQQYLDKNPDGYCPHHSTGIPCGVEA GT:EXON 1|1-217:0| SW:ID MSRA_CORGB SW:DE RecName: Full=Peptide methionine sulfoxide reductase msrA; Short=Protein-methionine-S-oxide reductase; EC=1.8.4.11;AltName: Full=Peptide-methionine (S)-S-oxide reductase; Short=Peptide Met(O) reductase; SW:GN Name=msrA; OrderedLocusNames=cgR_2830; SW:KW Complete proteome; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->217|MSRA_CORGB|e-133|100.0|217/217| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 11->213|1fvaB|1e-56|50.5|200/201| RP:PDB:NREP 1 RP:PDB:REP 48->213|3e0mC|2e-51|38.6|158/313| RP:PFM:NREP 1 RP:PFM:REP 55->204|PF01625|4e-40|61.1|144/156|PMSR| HM:PFM:NREP 1 HM:PFM:REP 49->206|PF01625|1.9e-53|48.4|153/156|PMSR| GO:PFM:NREP 3 GO:PFM GO:0016671|"GO:oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor"|PF01625|IPR002569| GO:PFM GO:0019538|"GO:protein metabolic process"|PF01625|IPR002569| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01625|IPR002569| RP:SCP:NREP 1 RP:SCP:REP 11->204|1ff3A|1e-64|49.5|190/211|d.58.28.1| HM:SCP:REP 5->217|1ff3A_|4e-64|42.9|210/0|d.58.28.1|1/1|Peptide methionine sulfoxide reductase| OP:NHOMO 1514 OP:NHOMOORG 995 OP:PATTERN ------11------1---------21113111211---1111-21111-1111-----1--1----11 132-111111111111111-11111211111111111111111111111111111111--11111111111-11111111111-----1111-111---11212241142--------------111111111111111111112-222211211222222221212223122222222222211111--111122222222222222222111122221132331111111633333323333333333333112122321-133112211111222211122222112222222222222222222222222112221111-11111111111-2--111-111111111----221----1------1221-22222-----133222122222211111111111-22122133222-2111223222331223122111112221111111113311111-----------------------------122231111122222222111122421111112231213-11111111121212112221111-111111111221111111112111111111122121111212111111111111111111111111-11211112121422432322223252222222222---2111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---211111223212122111-1--1111111111111112321211211233111111111222122222122222222233333221111111111111111221122--------111----1-1111-11---11111-1111-11------111 ----111-21111111111111111111111111111111111111111111111111-1--31111111111111111111111111-11111-111111-1222-1F12232321111111121111461-2141111111111111-1111111122111211-3221-1121456c3342353461676441229 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 95.4 SQ:SECSTR ##########cccGGGccccccccccccccccTTTcccccccccTTcEEEEEEcccHHHHHHHHHTcTTEEEEEEEEEccccccccTTTHHHccHTcEEEEEEEEETTTccHHHHHHHHHHHcccccccEETTEEcGGGccEEEEccGGGHHHHHHHHHHHHHHHccccccccccEEEEcccccEEEccTTTTTHHHHcTTccccccGGGGGccccc DISOP:02AL 1-7,11-13,217-218| PSIPRED cccccccccccccHHHcccccccccccccccccccccccccccccccEEEEEEEEEHHHHHHHHHHcccEEEEEEEEcccccccccHHHHcccccccEEEEEEEEccccccHHHHHHHHHHcccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccEEccHHHHHHHHHccccccccccccccccccc //