[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55881.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->38 PF08962 * DUF1876 0.00038 24.1 29/87  
:PROS 36->47|PS00455|AMP_BINDING

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55881.1 GT:GENE BAF55881.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 3180728..3180883 GB:FROM 3180728 GB:TO 3180883 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55881.1 LENGTH 51 SQ:AASEQ MKNHFCARKQITESDSLLRTRVYAKLHSADRSSEKMGDGSGSSSGLKVICP GT:EXON 1|1-51:0| PROS 36->47|PS00455|AMP_BINDING|PDOC00427| HM:PFM:NREP 1 HM:PFM:REP 10->38|PF08962|0.00038|24.1|29/87|DUF1876| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,29-44| PSIPRED ccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcc //