[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55885.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->54 PF09074 * Mer2 0.00053 20.5 39/193  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55885.1 GT:GENE BAF55885.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3183617..3183799) GB:FROM 3183617 GB:TO 3183799 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55885.1 LENGTH 60 SQ:AASEQ MQLREDIVVTRTQGATVIANLPRNLEDFRQAQKRTIVGQVKNWWKDLTNQRETYPSAQAA GT:EXON 1|1-60:0| HM:PFM:NREP 1 HM:PFM:REP 16->54|PF09074|0.00053|20.5|39/193|Mer2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,54-61| PSIPRED ccccHHEEEEEcccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //