[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55890.1
DDBJ      :             hypothetical protein
Swiss-Prot:SSB_CORGL    RecName: Full=Single-stranded DNA-binding protein;         Short=SSB;AltName: Full=Helix-destabilizing protein;

Homologs  Archaea  0/68 : Bacteria  541/915 : Eukaryota  6/199 : Viruses  13/175   --->[See Alignment]
b.40.4
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->120 1x3eB PDBj 2e-49 75.2 %
:RPS:PDB   1->121 3eivB PDBj 1e-26 72.1 %
:RPS:SCOP  4->120 1ue1A  b.40.4.3 * 3e-29 70.5 %
:HMM:SCOP  3->156 1se8A_ b.40.4.3 * 2.7e-44 36.8 %
:RPS:PFM   8->107 PF00436 * SSB 2e-19 49.0 %
:HMM:PFM   7->107 PF00436 * SSB 5.3e-32 46.5 99/104  
:BLT:SWISS 1->123,196->225 SSB_CORGL 1e-66 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55890.1 GT:GENE BAF55890.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3187250..3187927) GB:FROM 3187250 GB:TO 3187927 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55890.1 LENGTH 225 SQ:AASEQ MAIGDTNITVVGNIVADPELRFTPSGAAVANFRIASTPRSFNRQTNQWEDGEALFLTVNVWRQAAENVAESLSKGMRVIVTGRLKQRSYETREGEKRSVFEVEADEVGPSLTFAKADVQRTPRGGNSGGNYGGGNQGGGFGGNQGNQQGGFSNQNSGGFGGNQGNQQQSNQGGFGGNQNQSQGNNFNQGGFGGGSPQAAPDNDPWNSAPPAGSGGFGGADDEPPF GT:EXON 1|1-225:0| SW:ID SSB_CORGL SW:DE RecName: Full=Single-stranded DNA-binding protein; Short=SSB;AltName: Full=Helix-destabilizing protein; SW:GN Name=ssb; OrderedLocusNames=Cgl2982, cg3307; SW:KW Complete proteome; DNA damage; DNA repair; DNA replication;DNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->123,196->225|SSB_CORGL|1e-66|100.0|153/225| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| SEG 124->195|ggnsggnygggnqgggfggnqgnqqggfsnqnsggfggnqgnqqqsnqggfggnqnqsqgnnfnqggfgggs| SEG 207->219|sappagsggfgga| BL:PDB:NREP 1 BL:PDB:REP 4->120|1x3eB|2e-49|75.2|117/119| RP:PDB:NREP 1 RP:PDB:REP 1->121|3eivB|1e-26|72.1|111/111| RP:PFM:NREP 1 RP:PFM:REP 8->107|PF00436|2e-19|49.0|98/104|SSB| HM:PFM:NREP 1 HM:PFM:REP 7->107|PF00436|5.3e-32|46.5|99/104|SSB| GO:PFM:NREP 1 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF00436|IPR000424| RP:SCP:NREP 1 RP:SCP:REP 4->120|1ue1A|3e-29|70.5|112/113|b.40.4.3| HM:SCP:REP 3->156|1se8A_|2.7e-44|36.8|152/0|b.40.4.3|1/1|Nucleic acid-binding proteins| OP:NHOMO 770 OP:NHOMOORG 560 OP:PATTERN -------------------------------------------------------------------- -111423111322221222-221122222222222212222223112241123341222222222132221222232222211--11112-111---------2-1-111--------------1111222221222222211121-------------------------------------11-1111-2122222212212111111122122112132111411222113322222212443222112141111112111211122111111322311212111111111212121132212221112211111111111213211111223211-221111-12131--112113111111---1--1-11----------------------------------------------------------------------------------------------------------------------------1111121111111111221111111113111221133112121-1111-1211111121111111---11111--11111111111111212113111111111---1----1--1--------11113311111111111111111111111111-1111--1111------11-11-------1-1----------------------211---111111111111111111-----------11111111111---111111----1111111112112111-221----------111111-1111----1111----------111111111--111----------------1-11-111--------11----1------------------111----------111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------1------111---------------- -----------------------------------------1------------------------------------1---11----------1------------11-------------1----11-----111-------------------------------------- STR:NPRED 123 STR:RPRED 54.7 SQ:SECSTR ccccccEEEEEEEEccccEEEEcTTccEEEEEEEEEEEEEEEEEEccccccccEEEEEEEEHHHHHHHHHHccTTcEEEEEEEEEEEEEEcTTccEEEEEEEEEEEEEEcccccccccccccc###################################################################################################### DISOP:02AL 1-1,44-46,109-215,219-220| PSIPRED cccccEEEEEEEEEccccEEEEcccccEEEEEEEEEcccccccccccEEcccEEEEEEEEEccHHHHHHHHcccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccc //