[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55894.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:486 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   197->358 PF09594 * DUF2029 1e-09 33.1 %
:HMM:PFM   153->378 PF09594 * DUF2029 4e-31 26.2 214/241  
:HMM:PFM   396->448 PF05230 * MASE2 8.8e-06 28.0 50/91  
:BLT:SWISS 164->409 GPI14_KLULA 2e-04 18.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55894.1 GT:GENE BAF55894.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3188799..3190259) GB:FROM 3188799 GB:TO 3190259 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55894.1 LENGTH 486 SQ:AASEQ MDQKLDQQKVDRVSPGDSEPVARDFINAIGGRFGRFAQVGTQRFWTPLRVLITTSLVFLAIGFLTKANCIQGSRGTDGVVSLNWSGSRQYTSACYNDIVPLYGGRGIDAPGFPYAFSWQEGDLTRYMEYPVLGGIFQWICGIITRFLYPVVDVIPFHTLPESGLYFIVTALALAFFWVLVIRMMVELTGNRVWDTVLVAASPLVAVHAFTNWDTPAIAAVIGAMLAVKRGNPLVAGVLIGAGTAFKLWPLYLLGAYLVLAVKNKNLKPFITMAAAAAVTWLVVNVPVMIAYPKAWNEFLRLNRERGAEWTTIYQVIDRNLPINLNDPVLLNVLSFGLFGASCVAILILGLKVQRTPRVAELAFLIVAAFLLFNKVWSPQYSLWLVPLAVLAFPQWKVLFPWMVTDAMVWPILMWHMLGTDNKGLPHEMLDLIVISRDAFIVVMIVGVIRQMFGRRADPVLDAHAGRDLLAGPFGAGERRKALKEVS GT:EXON 1|1-486:0| BL:SWS:NREP 1 BL:SWS:REP 164->409|GPI14_KLULA|2e-04|18.9|243/100| TM:NTM 11 TM:REGION 46->68| TM:REGION 129->151| TM:REGION 162->184| TM:REGION 189->210| TM:REGION 216->228| TM:REGION 236->258| TM:REGION 270->292| TM:REGION 327->349| TM:REGION 364->386| TM:REGION 397->419| TM:REGION 428->450| SEG 250->261|lyllgaylvlav| SEG 359->372|aelaflivaafllf| RP:PFM:NREP 1 RP:PFM:REP 197->358|PF09594|1e-09|33.1|151/236|DUF2029| HM:PFM:NREP 2 HM:PFM:REP 153->378|PF09594|4e-31|26.2|214/241|DUF2029| HM:PFM:REP 396->448|PF05230|8.8e-06|28.0|50/91|MASE2| OP:NHOMO 55 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111211111---------11112----11-1121111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,480-487| PSIPRED cccHHHHHHccccccccccHHHHHHHHHccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHEEEEEEEEcccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcc //