[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55900.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->105 1iujB PDBj 2e-09 36.0 %
:RPS:PDB   3->67 2bbeA PDBj 5e-11 18.5 %
:RPS:SCOP  3->103 1iujA  d.58.4.5 * 8e-12 32.0 %
:HMM:SCOP  1->105 1sqeA_ d.58.4.5 * 3.4e-23 40.4 %
:RPS:PFM   3->65 PF03992 * ABM 4e-04 34.9 %
:HMM:PFM   3->76 PF03992 * ABM 9.8e-20 29.7 74/78  
:BLT:SWISS 6->69 YHGC_BACSU 1e-07 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55900.1 GT:GENE BAF55900.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3195185..3195508) GB:FROM 3195185 GB:TO 3195508 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55900.1 LENGTH 107 SQ:AASEQ MSIVKINAISVPEGAGEELEKRFAARQNAVDSAPGFEGFQLLRPVSGEDRYFVVTQWADEDSYNAWRDAEKAKGGHGQGAHGSDKKPVASGASLLEFEVVLGSTGAE GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 6->69|YHGC_BACSU|1e-07|33.3|63/166| SEG 71->82|kakgghgqgahg| BL:PDB:NREP 1 BL:PDB:REP 4->105|1iujB|2e-09|36.0|100/103| RP:PDB:NREP 1 RP:PDB:REP 3->67|2bbeA|5e-11|18.5|65/103| RP:PFM:NREP 1 RP:PFM:REP 3->65|PF03992|4e-04|34.9|63/78|ABM| HM:PFM:NREP 1 HM:PFM:REP 3->76|PF03992|9.8e-20|29.7|74/78|ABM| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF03992|IPR007138| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF03992|IPR007138| GO:PFM GO:0017000|"GO:antibiotic biosynthetic process"|PF03992|IPR007138| RP:SCP:NREP 1 RP:SCP:REP 3->103|1iujA|8e-12|32.0|100/102|d.58.4.5| HM:SCP:REP 1->105|1sqeA_|3.4e-23|40.4|104/0|d.58.4.5|1/1|Dimeric alpha+beta barrel| OP:NHOMO 50 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- ------11222-1-11111-1-111111111-11111111-2111-111------11---11--1111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 97.2 SQ:SECSTR #cEEEEEEEEEcTTcHHHHHHHHHTTHHHHHTcTTEEEEEEEEccccTTEEEEEEEEccHHHHHHHHHcHcHHHHHHTTcTTTccGGGcccccEEEEEccccccc## DISOP:02AL 72-90,105-108| PSIPRED ccEEEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEccHHHHHHHHccHHHHHHHccccccccccccccccccEEEEEEEcccccc //