[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55909.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  572/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
a.156.1b.113.1g.39.1
:269 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   113->269 1r2zA PDBj 3e-19 33.1 %
:RPS:PDB   2->268 1ee8A PDBj 5e-49 27.6 %
:RPS:SCOP  1->115 1kfvA2  b.113.1.1 * 3e-15 20.5 %
:RPS:SCOP  123->192 1k3wA1  a.156.1.2 * 2e-21 30.0 %
:RPS:SCOP  233->268 1ee8A3  g.39.1.8 * 3e-10 36.1 %
:HMM:SCOP  2->124 1k3xA2 b.113.1.1 * 2e-20 29.2 %
:HMM:SCOP  124->217 1r2zA1 a.156.1.2 * 4.8e-23 29.8 %
:HMM:SCOP  217->268 1ee8A3 g.39.1.8 * 7.6e-12 26.9 %
:RPS:PFM   27->96 PF01149 * Fapy_DNA_glyco 8e-04 40.3 %
:RPS:PFM   123->207 PF06831 * H2TH 4e-10 35.3 %
:HMM:PFM   123->207 PF06831 * H2TH 3.2e-20 28.2 85/93  
:HMM:PFM   2->96 PF01149 * Fapy_DNA_glyco 1.9e-13 30.4 92/116  
:HMM:PFM   247->268 PF06827 * zf-FPG_IleRS 1.2e-05 40.9 22/30  
:BLT:SWISS 1->268 Y2491_MYCBO 2e-52 42.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55909.1 GT:GENE BAF55909.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 3205159..3205968 GB:FROM 3205159 GB:TO 3205968 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55909.1 LENGTH 269 SQ:AASEQ MPEGHVIHRLAGELTKHFGETVLDATSPQGRFASEAAIINGHRIAVAEAYGKHLFVEFDADHPEHILYIHLGLIGTLQFEPAEETRGQIRLHLSDGEIAANLRGPQWCRLITDAERTQAIGKLGADPIRDDADPEPIRIKVQRSGRSIGSLLMDQKLFAGVGNIYRAETLFRLGISPFTIGKDITTAQFRSIWADLVGLMKDGVVAGRIDTVRPEHTPEAMGRPPRKDDHGGEVYTYRRTGQECFLCETPIKEQVMEGRNLFWCPGCQR GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 1->268|Y2491_MYCBO|2e-52|42.2|263/268| BL:PDB:NREP 1 BL:PDB:REP 113->269|1r2zA|3e-19|33.1|151/273| RP:PDB:NREP 1 RP:PDB:REP 2->268|1ee8A|5e-49|27.6|257/266| RP:PFM:NREP 2 RP:PFM:REP 27->96|PF01149|8e-04|40.3|67/118|Fapy_DNA_glyco| RP:PFM:REP 123->207|PF06831|4e-10|35.3|85/92|H2TH| HM:PFM:NREP 3 HM:PFM:REP 123->207|PF06831|3.2e-20|28.2|85/93|H2TH| HM:PFM:REP 2->96|PF01149|1.9e-13|30.4|92/116|Fapy_DNA_glyco| HM:PFM:REP 247->268|PF06827|1.2e-05|40.9|22/30|zf-FPG_IleRS| GO:PFM:NREP 10 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF01149|IPR012319| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF01149|IPR012319| GO:PFM GO:0006284|"GO:base-excision repair"|PF01149|IPR012319| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01149|IPR012319| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF01149|IPR012319| GO:PFM GO:0003684|"GO:damaged DNA binding"|PF06831|IPR015886| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF06831|IPR015886| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF06831|IPR015886| GO:PFM GO:0008270|"GO:zinc ion binding"|PF06831|IPR015886| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF06831|IPR015886| RP:SCP:NREP 3 RP:SCP:REP 1->115|1kfvA2|3e-15|20.5|112/131|b.113.1.1| RP:SCP:REP 123->192|1k3wA1|2e-21|30.0|70/90|a.156.1.2| RP:SCP:REP 233->268|1ee8A3|3e-10|36.1|36/56|g.39.1.8| HM:SCP:REP 2->124|1k3xA2|2e-20|29.2|120/124|b.113.1.1|1/1|N-terminal domain of MutM-like DNA repair proteins| HM:SCP:REP 124->217|1r2zA1|4.8e-23|29.8|94/0|a.156.1.2|1/1|S13-like H2TH domain| HM:SCP:REP 217->268|1ee8A3|7.6e-12|26.9|52/56|g.39.1.8|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 705 OP:NHOMOORG 582 OP:PATTERN -------------------------------------------------------------------- 3221322222211232323-23--4222222332322222-2-3431122112332131111212153321----------------------------1--------1---------------1-----------11--11111-2111111111111111111111111111211-11211-1-11---111111111111111111111111111111-11111111111-111111111111111111-1---11---1-11--1111---1111111111111111111111111--11---------1111111111--------------------------------122--111111-------1-2-111-1--1---11---1--------------------------1--111---------1111-111111111111111111111---111--1111----1-1111111-11-1111--11-1-1111111111111111111111111111-1--1-1-1--1---1----111111111111111111-1111----11--1---111111-11111-111-1--------------------------1111111-11111-----11111111111111--1-1-1------22-12111111111111-111111111111111111122211111222222222222222221111111--111111111111---1-----1111111-1111-11111111111-111111-1-111111111111111111111111111112111111111111121111111112222-11----------------------1------11----111-1--1------------- ------1-----------------------------------------------------------------------------------------------------2------------------------------------------------------1------------111D----11------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 100.0 SQ:SECSTR EccHHHHHHHHHHHHHHHTcEEEEEEcccTTTEEcGGGGTTEEEEEEEEETTEEEEEETTTEcTTEEEEEcTTTcEEEccccTTEEEEEEEEEcccEEEEEcTTccccEEEEccTTcTHHHHccccTTcTTccHHHHHHHHHTccccHHHHHHHccccTTccHHHHHHHHHHTTccccccGGGccHHHHHHHHHHHHHHHHHHHHTTccccccccccccTTccccccGGGccccccTTcTTcccTTTccccEEEEccccEEEEcTTTTc PSIPRED cccHHHHHHHHHHHHHHHcEEEEEEEEccccccccHHHHcccEEEEEEEEccEEEEEEccccccEEEEEEccccEEEEEEcccccccEEEEEEccccEEEEccccEEEEEEcHHHcccHHHHHccccccccccHHHHHHHHccccccHHHHHHccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccEEEEEccccccccccccEEEEEEEccEEEEEcccccc //