[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55912.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  380/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
b.35.1c.2.1
:337 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->337 3fbgA PDBj 6e-57 39.6 %
:RPS:PDB   4->335 2dm6A PDBj 3e-31 12.6 %
:RPS:SCOP  33->151 1o89A1  b.35.1.2 * 1e-21 22.2 %
:RPS:SCOP  127->287 1h2bA2  c.2.1.1 * 3e-13 15.1 %
:HMM:SCOP  17->164 1m6hA1 b.35.1.2 * 2.1e-33 37.2 %
:HMM:SCOP  127->291 1xa0A2 c.2.1.1 * 5.1e-29 36.6 %
:RPS:PFM   43->97 PF08240 * ADH_N 9e-05 40.0 %
:RPS:PFM   172->277 PF00107 * ADH_zinc_N 6e-07 36.2 %
:HMM:PFM   41->100 PF08240 * ADH_N 4e-12 31.7 60/109  
:HMM:PFM   168->219 PF00107 * ADH_zinc_N 9.2e-11 35.3 51/130  
:HMM:PFM   284->334 PF06819 * Arc_PepC 0.00056 23.5 51/111  
:BLT:SWISS 12->337 ZDH1_STAEQ 3e-57 36.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55912.1 GT:GENE BAF55912.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3207854..3208867) GB:FROM 3207854 GB:TO 3208867 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55912.1 LENGTH 337 SQ:AASEQ MSVQMDTPDPTMSAVAMLDSIPSDQPDFLVDVEVDRPTPGPHDLLVHIEAVSINPVDTKVRMRAGKQKHPKILGFDAAGEVVTVGSQVTLFNAGDKVFYAGSNQRPGSNAQYQVVDERLVGHAPQSLEPHDAAALPLVALTAWEALFDRLGVTQSSTGTLLVLGGSGGVPSALIQIARALTGLKVVATASRPESAEWVTKLGAHEVIDHSKDLSEQISDVDFVFSSWTTGREVELATLMKPQSHLVLIDDPVDPNLGAFKQKAIALHWEFMFTRAMFNTPDMGEQGKILNKIADMVDRGQFQAVTATVLEGLNAANIMEGHRLVEQGKTSGKIVVRI GT:EXON 1|1-337:0| BL:SWS:NREP 1 BL:SWS:REP 12->337|ZDH1_STAEQ|3e-57|36.0|325/336| SEG 152->169|vtqsstgtllvlggsggv| BL:PDB:NREP 1 BL:PDB:REP 18->337|3fbgA|6e-57|39.6|318/336| RP:PDB:NREP 1 RP:PDB:REP 4->335|2dm6A|3e-31|12.6|317/331| RP:PFM:NREP 2 RP:PFM:REP 43->97|PF08240|9e-05|40.0|55/108|ADH_N| RP:PFM:REP 172->277|PF00107|6e-07|36.2|105/128|ADH_zinc_N| HM:PFM:NREP 3 HM:PFM:REP 41->100|PF08240|4e-12|31.7|60/109|ADH_N| HM:PFM:REP 168->219|PF00107|9.2e-11|35.3|51/130|ADH_zinc_N| HM:PFM:REP 284->334|PF06819|0.00056|23.5|51/111|Arc_PepC| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00107|IPR013149| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00107|IPR013149| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00107|IPR013149| RP:SCP:NREP 2 RP:SCP:REP 33->151|1o89A1|1e-21|22.2|117/143|b.35.1.2| RP:SCP:REP 127->287|1h2bA2|3e-13|15.1|159/172|c.2.1.1| HM:SCP:REP 17->164|1m6hA1|2.1e-33|37.2|145/198|b.35.1.2|1/1|GroES-like| HM:SCP:REP 127->291|1xa0A2|5.1e-29|36.6|161/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1295 OP:NHOMOORG 531 OP:PATTERN ----------------------------1-11------------------11------------1--- -51-7--1111-1-2------3--161-11112212-445---151--112-2321----23-15234421----------11------------------2-2-B111------------------------------1----3-21231121111------1-122213--------------111---2-155756556-47545612--1-545-1122632222224--11111111111111321122-2-33----1651133522121111-----------------------------------11---111-----1-----------------------------------------------3211------4-52311232222------------45143223-62-466243-7754153-12-1-1--1-----------111211-1------------------------------13-121---2444744111115554111113426-421--11-111--33213-151--1111---------11-1--1---1--1-----11--1-----11213-----------------------------21121-21411-222311-1112-1--211---1---------21-4-21------------------------------22231--1----------------2---------111111111111----11-112222-2331---------------1111311--2-123222454331341322-----1----1--3-----111112332323212-------122--------------------------------------------------11- ----21--11----244325462E9E41112112221112112111425E99CF443112124------1----1------22212-2-68443391-2-2--33--3-74322222111-222222216C2-3331--13-25212212212312222-2111231--1-1111---1----129682426--E86A- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 337 STR:RPRED 100.0 SQ:SECSTR ccHcccccccEEEEEEEccccccccGGGEEEEEEEcccccTTcEEEEEEEEEccTHHHHHHHTTTccTTccccccEEEEEEEEccTTccTTcEEEEccccccccccEEEEccTTEEEccTTccTTccGGGGGTTTcHHHHHHHHHHHTTTccccccEEEEccTTcHHHHHHHHHHHHHHHTTcEEEEEEccHHHHHHHHHTTccEEEETTccccHHTTcEEEEEEcccHHHHHHHHTTEEEEEEEEEcccGGGTTTTTccccccHHHTTcEEEEccGGGccTHHHHHHHHHHHHHHHTTcccccEEEEEEcGGGHHHHHHHHHHHTTccccEEEEET DISOP:02AL 1-6,8-8| PSIPRED cccccccccccEEEEEEEccccccccccEEEEEEccccccccEEEEEEEEEEccHHHHHHHcccccccccccccccEEEEEEEEcccccccccccEEEEEcccccccccEEEEEEcHHHcEEccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEEEEccccHHHHHHcccEEEEcccHHHHHHHHHHHccccEEEEEcccccccHHHHHHccEEEEEEEEEEEHHcccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccEEEEEc //