[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55917.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->148 PF04892 * VanZ 6e-05 34.7 %
:HMM:PFM   14->148 PF04892 * VanZ 1.2e-22 27.2 125/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55917.1 GT:GENE BAF55917.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3214658..3215251) GB:FROM 3214658 GB:TO 3215251 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55917.1 LENGTH 197 SQ:AASEQ MRAPSISMIALALIAYSAVMVSLTMLKSFFVIGLLWVPEAHRNRSISLLPFNDFIESSSWFSPLFGYGGNFAFFVPFGVLFYVLLKTSGSWHKNLVIHTMRVGALFSLTIEISQYVFMLGYSDIDDLIFNTLGAGAGALIAKIFGERFFKVWVWLALILAVVFAVLVALGPRLGDPDKVVDLGQAQQLSNTPMHVFA GT:EXON 1|1-197:0| TM:NTM 5 TM:REGION 10->32| TM:REGION 68->90| TM:REGION 98->120| TM:REGION 124->146| TM:REGION 150->172| SEG 133->138|gagaga| SEG 151->169|vwvwlalilavvfavlval| RP:PFM:NREP 1 RP:PFM:REP 22->148|PF04892|6e-05|34.7|118/123|VanZ| HM:PFM:NREP 1 HM:PFM:REP 14->148|PF04892|1.2e-22|27.2|125/133|VanZ| OP:NHOMO 15 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----222222--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccEEEEEHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHcc //