[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55922.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.62.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->174 2b2xB PDBj 9e-13 17.1 %
:RPS:SCOP  1->137 1jeqB2  c.62.1.4 * 6e-15 17.5 %
:HMM:SCOP  1->185 1qc5A_ c.62.1.1 * 2.7e-20 30.2 %
:HMM:PFM   1->173 PF00092 * VWA 1.3e-09 23.2 155/179  
:BLT:SWISS 2->186 YWMD_BACSU 5e-14 29.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55922.1 GT:GENE BAF55922.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3219755..3220447) GB:FROM 3219755 GB:TO 3220447 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55922.1 LENGTH 230 SQ:AASEQ MLVLDSSGSMVTPDAGGQSRSDAANQFIDELAGTFDLGLVTYGGNTGETPEDYEAGCQDITVVRGPTNGQAEQLKQHIDGLQPRGYTPIGESLRKAVAELPEGGSGTILLVSDGIATCTPPPVCEVAAELADQGVDLVINTVGFTLDESARAVLECIAQAGNGTYADASDADSLVAELKQAATRTAVGYESDLEQIDGNSSQTSPTPISDDVELFKADLPALDNKDGEVT GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 2->186|YWMD_BACSU|5e-14|29.6|179/224| RP:PDB:NREP 1 RP:PDB:REP 1->174|2b2xB|9e-13|17.1|152/176| HM:PFM:NREP 1 HM:PFM:REP 1->173|PF00092|1.3e-09|23.2|155/179|VWA| RP:SCP:NREP 1 RP:SCP:REP 1->137|1jeqB2|6e-15|17.5|137/222|c.62.1.4| HM:SCP:REP 1->185|1qc5A_|2.7e-20|30.2|162/0|c.62.1.1|1/1|vWA-like| OP:NHOMO 46 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -----2--3312-1----------------------------------------------11-----111---------------------------------------------------------------------11------------------------------------------1---------2-------1---------1122----------------2-------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------1-----------------1-111-----12---------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------11------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 77.8 SQ:SECSTR EEEEEccTTc#####ccHccHHHHHHHHHHHTTccTEEEEEEcccEEcccEEEEEcHHEEEEEcTTccccHHHHHHTTccccccccccHHHHHHHHHTTTGGTcccEEEEEEccccTcTGGGHHHHHHHHHHTTcEEEEEEEcTTcccHHHHHHHTTccccTTccEEEccGGGGHHHHHHHHHH############################################## DISOP:02AL 228-231| PSIPRED cEEEEcccccccccccHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccEEEEEccccccHHHHHHHHHcccccccccHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccccccEEccccccEEEEEcccccHHHHHHcccHHcccccccc //