[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55926.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->91 PF04304 * DUF454 3e-05 31.3 %
:HMM:PFM   24->91 PF04304 * DUF454 1.9e-17 32.4 68/71  
:BLT:SWISS 9->81 YBAN_SHIFL 1e-07 36.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55926.1 GT:GENE BAF55926.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 3225801..3226166 GB:FROM 3225801 GB:TO 3226166 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55926.1 LENGTH 121 SQ:AASEQ MPVIPTTPFLLLSAFCFARSSERLHNYLISHRIFGEYISNYYNHAMTPRHKFRTLLTLWCGIILSCVLIGATIPWIILPLIATGVSIHIIRLKPRPEATPTASSPEADSGSEPHFADDHKA GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 9->81|YBAN_SHIFL|1e-07|36.6|71/125| TM:NTM 2 TM:REGION 1->23| TM:REGION 61->83| RP:PFM:NREP 1 RP:PFM:REP 25->91|PF04304|3e-05|31.3|67/70|DUF454| HM:PFM:NREP 1 HM:PFM:REP 24->91|PF04304|1.9e-17|32.4|68/71|DUF454| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ------1-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1----------------------------------------------1-1------------------------------------------------------------------------------------------------------------1-------------------------------------1-----------------------------------------------1---------1--111--1--------------------------------------------------------------------------------------------------------------------1-1----------------------11--------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,96-122| PSIPRED ccccccHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccHHccccccccccccccc //