[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55931.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  171/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.110.2
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->165 1mkmB PDBj 2e-11 25.2 %
:RPS:PDB   22->65 1biaA PDBj 4e-06 27.3 %
:RPS:PDB   91->255 3d3oA PDBj 4e-19 13.5 %
:RPS:SCOP  18->80 1mkmA1  a.4.5.33 * 3e-08 23.8 %
:RPS:SCOP  92->251 1mkmA2  d.110.2.2 * 5e-20 19.4 %
:HMM:SCOP  18->86 1mkmA1 a.4.5.33 * 4.1e-08 33.3 %
:HMM:SCOP  92->251 1mkmA2 d.110.2.2 * 1.5e-30 33.1 %
:HMM:PFM   134->239 PF01614 * IclR 1e-12 25.5 106/129  
:HMM:PFM   20->68 PF09339 * HTH_IclR 3.3e-07 32.7 49/52  
:BLT:SWISS 18->231 KDGR_ERWCH 2e-11 25.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55931.1 GT:GENE BAF55931.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3229917..3230699) GB:FROM 3229917 GB:TO 3230699 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55931.1 LENGTH 260 SQ:AASEQ MIMDNVAPTQGLPPKEFLSSVDIALQLILLLRDSGSLTISGAAETLGVGASTIHRSMSMLVYRGFAVRSESRTYLPGSALATSALQPGLGADLTKKCSHYMESIGKETGETTHLVILQGDSVHFIHSVEGSLPVRVGNRRGQVMPAIQNSGGLVMLAEMSARELRALYSSLGDEEFENLRKRLRRTRDRGHGANFGFFEQDVSAVAEPLLNDVGDVLGAITVAVPSNRFREVYPKAVQVLERHMRDLNKALADYRVPEKG GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 18->231|KDGR_ERWCH|2e-11|25.6|211/305| SEG 180->189|rkrlrrtrdr| BL:PDB:NREP 1 BL:PDB:REP 27->165|1mkmB|2e-11|25.2|139/247| RP:PDB:NREP 2 RP:PDB:REP 22->65|1biaA|4e-06|27.3|44/292| RP:PDB:REP 91->255|3d3oA|4e-19|13.5|163/167| HM:PFM:NREP 2 HM:PFM:REP 134->239|PF01614|1e-12|25.5|106/129|IclR| HM:PFM:REP 20->68|PF09339|3.3e-07|32.7|49/52|HTH_IclR| RP:SCP:NREP 2 RP:SCP:REP 18->80|1mkmA1|3e-08|23.8|63/75|a.4.5.33| RP:SCP:REP 92->251|1mkmA2|5e-20|19.4|160/171|d.110.2.2| HM:SCP:REP 18->86|1mkmA1|4.1e-08|33.3|69/0|a.4.5.33|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 92->251|1mkmA2|1.5e-30|33.1|160/0|d.110.2.2|1/1|GAF domain-like| OP:NHOMO 218 OP:NHOMOORG 172 OP:PATTERN ------------------------1------------------------------------------- --1----1112----11----3---1------1121--43------1-----113----------18111------------------------------------------------------------------111------1-------------------------------------11--111-2--1111111111111-1--111111-1-2----------11-------------------------------------------------------------------------------------------1-----------------------------------1-1--2---1------------------------------------------------1---111----11--------113---11-1----------------------------------------------------111-1223211111122121111-13-5333---11--1---2-1-2----------------------------------------------1-------------------------------------------------------------------------------111---1111111111-111111111-111111111-----------1----------1--111-111--111111111111---------------------1-1---------------------1-----1-------12------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 90.0 SQ:SECSTR #####################HHHHHHHHHHTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEEEETTEEEEEEEEcccEEEEccHHHHHHHHHHHHHHHHccEEEEEEEETTEEEEEEEEcccccccccccTTccccGGcHHHHHTTcHHHHHHHHHHHHHGGGTccccHHHHHHHHHHHHcEEEEEccccTTEEEEEEEEEEETTEEEEEEEEEHHHHHHHHTHHHHHHHHHHHHHHHTTcccccc##### DISOP:02AL 1-20,255-261| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEcccccEEEHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEEEEEEccccEEEEccccccccccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHccEEEccccccccEEEEEEEEcccccEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //