[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55935.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  263/915 : Eukaryota  82/199 : Viruses  0/175   --->[See Alignment]
f.49.1
:417 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   199->384 1xfhA PDBj 8e-15 29.0 %
:RPS:SCOP  51->384 1xfhA  f.49.1.1 * 4e-34 19.3 %
:HMM:SCOP  10->386 2nwwA1 f.49.1.1 * 1e-78 31.3 %
:RPS:PFM   200->384 PF00375 * SDF 5e-19 38.8 %
:HMM:PFM   10->385 PF00375 * SDF 4.3e-76 28.0 372/390  
:BLT:SWISS 139->390 EAA3_RABIT 2e-20 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55935.1 GT:GENE BAF55935.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(3234025..3235278) GB:FROM 3234025 GB:TO 3235278 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55935.1 LENGTH 417 SQ:AASEQ MDIKSMSSSLLFRVIVAIILGIICSLFFPVWLAEIFTTFNGLFSNFLGFFIPVLIFSLIAPAIAGLGRGAGKWLGIVAAIAYASTIFSGLIAYGASQALYPWLLKDHQSVAEIDLDAGALQPYFNIEMPPPFEVMTALLLAFCLGLGMAVVKSDTLFKVTRELERVVMKTITAFVIPLLPLFIFGIFLGMGMNGGLLEIMSAFGKVLILAVVGTLLFLTIQFIIAGAVSKKNPWKLFKNMLPAYFTALGTSSSAATIPVTYQQTLKNDVDVNVAGFVVPLCATIHLAGSMMKIGLFAFAVVFIYDMEVNAGLAIGFLLMLGITMIAAPGVPGGAIMAATGMLSSMLGFNTEQVALMIAAYIAIDSFGTAANVTGDGAIAVIVNKFAKGQLHTTSPDEIEEDDRVAFDITPSDVEHHK GT:EXON 1|1-417:0| BL:SWS:NREP 1 BL:SWS:REP 139->390|EAA3_RABIT|2e-20|30.0|250/524| TM:NTM 9 TM:REGION 10->32| TM:REGION 43->65| TM:REGION 72->94| TM:REGION 133->155| TM:REGION 166->188| TM:REGION 201->223| TM:REGION 276->298| TM:REGION 308->330| TM:REGION 340->362| SEG 39->50|fnglfsnflgff| SEG 176->197|ipllplfifgiflgmgmnggll| BL:PDB:NREP 1 BL:PDB:REP 199->384|1xfhA|8e-15|29.0|186/405| RP:PFM:NREP 1 RP:PFM:REP 200->384|PF00375|5e-19|38.8|183/392|SDF| HM:PFM:NREP 1 HM:PFM:REP 10->385|PF00375|4.3e-76|28.0|372/390|SDF| GO:PFM:NREP 3 GO:PFM GO:0006835|"GO:dicarboxylic acid transport"|PF00375|IPR001991| GO:PFM GO:0016020|"GO:membrane"|PF00375|IPR001991| GO:PFM GO:0017153|"GO:sodium:dicarboxylate symporter activity"|PF00375|IPR001991| RP:SCP:NREP 1 RP:SCP:REP 51->384|1xfhA|4e-34|19.3|332/405|f.49.1.1| HM:SCP:REP 10->386|2nwwA1|1e-78|31.3|374/0|f.49.1.1|1/1|Proton glutamate symport protein| OP:NHOMO 740 OP:NHOMOORG 359 OP:PATTERN 112----------------------------------------------11-1-1111112------1 -----1111111111-------------------------------1-------111------------------1---1-1---1--1112-2111---12--211-11-------1-111112---------1---------------------------------------------------------1133333334444444422332144311323-2------3-1111111111111111--121------1---1111---1-----------111------------------------------1-------23--5555545353-111433323-61-1------2---3--11---211-------------1---------------------------------1---------------1---------------------------1121-11111--------1------2122-111---------------------------------1-1---------1--1------11111---------1--2--1-1--11-1---2-1------1------1---1--11111-----------1-1---22-2-1121221223312333332431322-------------1--1-------------------------------------1--------------------------------------------1-----1111---11---------------11111-1111-2--------1----1-------------222533332222221111111111-------5--1111---------1-------------------------------------1- ----------------111---------1----------------------1-11211----------------------------------1---------------114476774331345388-438L4-54513315314514313312623356243144--31264452---------1----1-22-2111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 44.6 SQ:SECSTR ######################################################################################################################################################################################################ccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHTHHHHHHHHHHccHHHHHHHHHHHHHTTTccTTTHHHHcGGGTTTccHHHHHHHHHHHHHHHHHTTccTTTTTTHHHHHHHHHHHHHccccTTTTTTTHHHHHHHTccTTcTTHHHHHHHHTTcHHHHTTHHHHHHHHHHHHHHH################################# DISOP:02AL 1-4,388-418| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHEEEEHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccccccccc //