[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55939.1
DDBJ      :             hypothetical protein
Swiss-Prot:TRPG_CORGL   RecName: Full=Anthranilate synthase component 2;         EC=4.1.3.27;AltName: Full=Anthranilate synthase component II;AltName: Full=Glutamine amido-transferase;

Homologs  Archaea  61/68 : Bacteria  766/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:208 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->207 1i7qB PDBj 3e-31 41.1 %
:RPS:PDB   1->173 3dkyE PDBj 2e-26 11.1 %
:RPS:SCOP  1->205 1qdlB  c.23.16.1 * 3e-28 29.3 %
:HMM:SCOP  1->205 1qdlB_ c.23.16.1 * 3.1e-44 36.8 %
:RPS:PFM   6->194 PF00117 * GATase 3e-21 45.0 %
:HMM:PFM   5->203 PF00117 * GATase 1.9e-41 33.9 180/192  
:BLT:SWISS 1->208 TRPG_CORGL e-121 99.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55939.1 GT:GENE BAF55939.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 3237929..3238555 GB:FROM 3237929 GB:TO 3238555 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55939.1 LENGTH 208 SQ:AASEQ MTHVVLIDNHDSFVYNLVDAFAVAGYKCTVFRNTVPVETILAANPDLICLSPGPGYPADAGNMMALIERTLSQIPLLGICLGYQALIEYHGGKVEPCGPVHGTTDNMILTDAGVQSPVFAGLATDVEPDHPEIPGRKVPIGRYHSLGCVVAPDGIESLGTCSSEIGDVIMAARTTDGKAIGLQFHPESVLSPTGPVILSRCVEQLLAN GT:EXON 1|1-208:0| SW:ID TRPG_CORGL SW:DE RecName: Full=Anthranilate synthase component 2; EC=4.1.3.27;AltName: Full=Anthranilate synthase component II;AltName: Full=Glutamine amido-transferase; SW:GN Name=trpG; OrderedLocusNames=Cgl3031, cg3360; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Glutamine amidotransferase; Lyase;Tryptophan biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->208|TRPG_CORGL|e-121|99.5|208/208| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0000162|"GO:tryptophan biosynthetic process"|Tryptophan biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 4->207|1i7qB|3e-31|41.1|180/192| RP:PDB:NREP 1 RP:PDB:REP 1->173|3dkyE|2e-26|11.1|153/180| RP:PFM:NREP 1 RP:PFM:REP 6->194|PF00117|3e-21|45.0|171/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 5->203|PF00117|1.9e-41|33.9|180/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 1->205|1qdlB|3e-28|29.3|191/195|c.23.16.1| HM:SCP:REP 1->205|1qdlB_|3.1e-44|36.8|190/195|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 1356 OP:NHOMOORG 944 OP:PATTERN 11-1--1111111111-1111111322222221121111111111111-111122211211111--11 1111332222221211123-221111222221211123431111111-111111111111111121223221111111----11111111111111-111-111111111--------------111111111111111121111111311111111111111111134311111111111112223321-11122222222122222211111122211122222222221112222222222222222222-----------11-------12-22211111111111111111111111111111111111--111----22-12---111-1-1122211111-1-111111222111--212112-111121111-----222112121111111111111111-22222222112-11112211111111221111111111111111111111-1222-----------------------------21111211111111111211111111111111111111111111111111111221111111111111111111111-2222112112221-111111111111123121111-22222112111111111111112222112222222222322222222222221-11111-1---222222222222222222-2222222222222222222222223322221222222222222222222223-221222212222221211-112222111222221221222221221111121223112222111311111111121122222112222222222222211111111112211111-221111--------------------------------------1--1-111113 ------1------121111-111-21111-1112211111111111111111111111111112121111222112212221112122-13112211111111111-13----------------------------------------------------------------1-1111J1211232331631232221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 100.0 SQ:SECSTR HHHHHHHTcccEEEccccccccHTEEEEEEccccccHHHHHHHHccEEcccHHHHHHHTTTccHHHHHTTcccccTTccEEETTccGGGccccHHHHHHHHHHHHHHHHTTccEccGcHHHHHcEEEccEETTTcHHHHHHHHHHTEEccHHHHHHHHTTTHHHHHHHHHHHHEccccEEEEcccTTcTTcTTHHHHHHHHHHHHHHH PSIPRED ccEEEEEEccccHHHHHHHHHHHcccEEEEEEccccHHHHHHccccEEEEccccccHHHccccHHHHHHHcccccEEEEcHHHHHHHHHcccEEEcccccccEEEEEEEccccccccccccccccccccccccccccEEEEEEEEEEEEEcccccEEEEEEEEccccEEEEEEEccccEEEEEccccccccccHHHHHHHHHHHHHcc //