[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55948.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.33.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->108 2gbwC PDBj 7e-05 32.7 %
:RPS:PDB   38->126 2e4qA PDBj 5e-13 23.6 %
:RPS:SCOP  38->126 1fqtA  b.33.1.1 * 1e-13 23.6 %
:HMM:SCOP  1->124 1jm1A_ b.33.1.1 * 5e-15 26.6 %
:RPS:PFM   39->110 PF00355 * Rieske 5e-07 33.3 %
:HMM:PFM   51->115 PF00355 * Rieske 4.5e-15 28.1 64/97  
:HMM:PFM   17->73 PF11599 * AviRa 0.00019 22.8 57/246  
:BLT:SWISS 64->110 QCRA_STRLI 3e-05 44.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55948.1 GT:GENE BAF55948.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 3248360..3248743 GB:FROM 3248360 GB:TO 3248743 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55948.1 LENGTH 127 SQ:AASEQ MTQPAPMCSRRMFLLGTATTFAGAFLAACGTEPDQEVAATEVPVGSSVILGSVIIAQPTEGNFVAYSSACPHQGSRITKVEGDTVICTNHKSVFNISDGSVVSGPAQNGLTSANLKQDGDTLSASVQ GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 64->110|QCRA_STRLI|3e-05|44.7|47/170| SEG 13->31|fllgtattfagaflaacgt| BL:PDB:NREP 1 BL:PDB:REP 53->108|2gbwC|7e-05|32.7|55/446| RP:PDB:NREP 1 RP:PDB:REP 38->126|2e4qA|5e-13|23.6|89/108| RP:PFM:NREP 1 RP:PFM:REP 39->110|PF00355|5e-07|33.3|72/95|Rieske| HM:PFM:NREP 2 HM:PFM:REP 51->115|PF00355|4.5e-15|28.1|64/97|Rieske| HM:PFM:REP 17->73|PF11599|0.00019|22.8|57/246|AviRa| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00355|IPR017941| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF00355|IPR017941| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00355|IPR017941| RP:SCP:NREP 1 RP:SCP:REP 38->126|1fqtA|1e-13|23.6|89/109|b.33.1.1| HM:SCP:REP 1->124|1jm1A_|5e-15|26.6|124/202|b.33.1.1|1/1|ISP domain| OP:NHOMO 33 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ----21111111-1-------1---1------211111---------1-------1----22111--221----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 74.8 SQ:SECSTR ################################cHHHHEGGGccTTcEEETTEEEEEEEETTEEEEEEcccTTTcccTTEEETTEEEcTTTccEEETTTccEEEcccccccccccEEEETTEEEEcTT DISOP:02AL 1-5| PSIPRED ccccccccHHHHHEEHHHHHHHHHHHccccccccccccHHcccccccEEEEEEEEEEcccccEEEEcccccccccccccccccEEEccccccEEEccccccccccccccccEEEEEEEccEEEEEEc //