[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00002
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:382 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  171->358 1j7iA  d.144.1.6 * 6e-07 18.8 %
:HMM:SCOP  137->377 1j7lA_ d.144.1.6 * 8.7e-18 23.9 %
:RPS:PFM   156->339 PF01636 * APH 6e-10 36.2 %
:HMM:PFM   160->343 PF01636 * APH 4.6e-13 23.5 162/238  
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00002 GT:GENE CIRG_00002 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 382 SQ:AASEQ MAKRKRHEESEGTSPKKSKAARFNIHTLSRLQKAVAADPEIDLTLYFPKDYSERLSEMRTPLLSSATPISAATTSGSVLEDDIRVFLRPSEPIAVIFPLSDSVCRMLAGTDMSEALIGLMQRSEILWKSPFPRKKMVFKCDGNIVVKAIKNAVDYTEYTTLLYLEVHKPTVPAPRPSGLLRVNNVSLIFMTYVPTTTLADIWTGLDIAQKRSIQHQLNEILADLRSLSCPDGMPLGGVRGEGCKDVRRHLRHSIEPILTIKDFKNFQFPSLRTPIFTEFIDRLCQPCIRPGQLEIQCVFTHGDLRPDNITVEASDGGQFRITGLLDWEYSGFYPEYYELIRSTNGLGPSGDDDWYLFLPECISPERYGMWWLLDYAHGRLVE SEG 64->77|ssatpisaattsgs| RP:PFM:NREP 1 RP:PFM:REP 156->339|PF01636|6e-10|36.2|163/221|APH| HM:PFM:NREP 1 HM:PFM:REP 160->343|PF01636|4.6e-13|23.5|162/238|APH| RP:SCP:NREP 1 RP:SCP:REP 171->358|1j7iA|6e-07|18.8|170/260|d.144.1.6| HM:SCP:REP 137->377|1j7lA_|8.7e-18|23.9|222/263|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 221 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------442-2--3272277ABAB2A66A8A5891331111222413-26------------------------------1J-4111---------------------------------------------------------------------------------------------3--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,59-59,67-67,81-81,95-95,101-101,109-110,115-116,118-118,121-123,129-129,382-383| PSIPRED cccHHHHHHHcccccccccccEEcHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHccccccccccccccEEcccEEEEEcccccEEEEEEccHHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEcccccHHHHHHHHHHHHcccccccccEEEEEEEccEEEEEEEEcccEEHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccEEEEccccccccEEEEccccccEEEEEEEccHHcccccHHHHHHHHHHHccccccccHHHHHcccccHHHHHHHHEEHHccccccc //