[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00304
DDBJ      :             
Swiss-Prot:NBP35_COCIM  RecName: Full=Cytosolic Fe-S cluster assembly factor NBP35;AltName: Full=Nucleotide-binding protein 35;

Homologs  Archaea  67/68 : Bacteria  769/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->97 1ii0A PDBj 4e-05 47.4 %
:BLT:PDB   108->301 2ph1A PDBj 3e-33 43.5 %
:RPS:PDB   80->309 2b9bA PDBj 7e-38 8.5 %
:RPS:SCOP  77->338 1cp2A  c.37.1.10 * 6e-40 16.8 %
:HMM:SCOP  58->309 1f48A2 c.37.1.10 * 9.9e-58 28.1 %
:RPS:PFM   78->125 PF09140 * MipZ 5e-06 48.9 %
:RPS:PFM   186->266 PF10609 * ParA 1e-24 62.8 %
:HMM:PFM   186->267 PF10609 * ParA 5.3e-38 67.1 79/81  
:HMM:PFM   76->114 PF02374 * ArsA_ATPase 3.8e-06 34.2 38/305  
:BLT:SWISS 1->342 NBP35_COCIM 0.0 100.0 %
:PROS 183->199|PS01215|MRP

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00304 GT:GENE CIRG_00304 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 342 SQ:AASEQ MAPSFEEPTVALGAASKAAPKLVAPEPEHCPGPESEQAGKGDACAGCPNQSICASAPKGPDPDIPIITARLSSIRHKILVLSGKGGVGKSTFTSLLANAFASNPDSTVGVMDTDICGPSIPKMMDVETETIHVSNAGWNPVWVSDNLAVMSVQFMLPNRDDAVIWRGPKKNGLIKQFLKDVEWGELDYLIVDTPPGTSDEHLSVNSFLKESGVDGAVLVTTPQEVSLLDVRKEIDFCRKAGIRILGLVENMSGFVCPKCTHESQIFKPTTGGGGRLAADMGIPFLGSVPLDPRVGMACDYGENFMDRYPESPASMALRKVVRTISRQVGEDPDEVLPETDAV SW:ID NBP35_COCIM SW:DE RecName: Full=Cytosolic Fe-S cluster assembly factor NBP35;AltName: Full=Nucleotide-binding protein 35; SW:GN Name=NBP35; ORFNames=CIMG_00315; SW:KW 4Fe-4S; ATP-binding; Complete proteome; Cytoplasm; Iron; Iron-sulfur;Metal-binding; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->342|NBP35_COCIM|0.0|100.0|342/342| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 183->199|PS01215|MRP|PDOC00935| BL:PDB:NREP 2 BL:PDB:REP 60->97|1ii0A|4e-05|47.4|38/550| BL:PDB:REP 108->301|2ph1A|3e-33|43.5|184/240| RP:PDB:NREP 1 RP:PDB:REP 80->309|2b9bA|7e-38|8.5|189/478| RP:PFM:NREP 2 RP:PFM:REP 78->125|PF09140|5e-06|48.9|47/62|MipZ| RP:PFM:REP 186->266|PF10609|1e-24|62.8|78/81|ParA| HM:PFM:NREP 2 HM:PFM:REP 186->267|PF10609|5.3e-38|67.1|79/81|ParA| HM:PFM:REP 76->114|PF02374|3.8e-06|34.2|38/305|ArsA_ATPase| RP:SCP:NREP 1 RP:SCP:REP 77->338|1cp2A|6e-40|16.8|250/269|c.37.1.10| HM:SCP:REP 58->309|1f48A2|9.9e-58|28.1|249/278|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1579 OP:NHOMOORG 1032 OP:PATTERN 11112111111111122111122221131122112211111112222221121122222231112-11 11121-1111111111111-111111111111111111211111111111111211111111211111111111111111111111111111-11111-11111111111--------------111111111111111111111111111111111111111111121211111111121111111122111122222222222222211111122111121111111111111111111111111111111----------------------------------------------------------------------1-11111111111111133111111-11111-12221321--11111111111111111111111111111111111111111111-11111111111111111111111111111311111122111111111111111111111111111111111111111111111111111112222111111111111111111111111112111111111111111111111211111111111111111111112331223331---1-1-2211111142111111111111111111111112111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113-111111--------1-1-------------------------1111111111111 2322443-83333333333333333333333333333333333333333332332233333233322223223332222223333322-35333333333333333244384633323233333331334J3-447133352332234113214334338F325432344311433233U3333333243334342224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 83.9 SQ:SECSTR ###################################################ccccccccccTTTEEEEccTccccEEEEEEEEEETTEEEEEEHHHEcTHTTcTTccTHHHHHHHccccccTTTHHHHHccHHHHHHGGGGcHHHHHHHHHHHHHHHHTTcccccccGGGccccHHHHHHHHGGGHHHHHHHHccccccHHHHHHcccHGGGcEEEEEEEETTTTEHHHHHHHHHEEEEEEEEEEEEEEEEEEEEEEEccEEETTEEccEEEccccEEEEETTEEEEcccTTcEEcccEEEccccccEETcHHHHHHHHHHTcccHcccccccccccc#### DISOP:02AL 342-343| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccEEcccccccEEcccccEEEcEEccccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccc //