[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00307
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->271 2po1A PDBj 2e-11 29.8 %
:RPS:PDB   39->288 2br2R PDBj 3e-23 27.0 %
:RPS:SCOP  43->209 1e3hA3  d.14.1.4 * 6e-14 12.5 %
:HMM:SCOP  36->217 1oysA1 d.14.1.4 * 5.5e-08 30.1 %
:HMM:PFM   43->209 PF01138 * RNase_PH 1.3e-29 35.9 128/132  
:BLT:SWISS 3->217 EXOS6_DANRE 1e-16 34.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00307 GT:GENE CIRG_00307 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 331 SQ:AASEQ MTDKRRINGPPGGTQPPVFLSPLSAENQKSIAERPIRSRKAAELRKIFLKSGVIPSASGSAYLELQPSNDPAYKSRTLIPPSSSLKLVCTVHGPRPLPRSAPFSPNLLLSTHVKFAPFAGRRRRGYIRDMYERDLAVHLETALGGMIIGDRWPKSGLDVTVNILEGEDDRWWGDSLSSGPLGGVDGWGSMNVLASCITVASAAIVDARIDCLDLLAGGVAAIVEEKDRMSQDTNSKEQGRYLVLDPDPSEHRDIASLCIVGYMPSRDEITEVWLKGDVSGVGYDSLMDGAVEAARAAQAIVLEAAKESAQRFANLPTKNLLDDNEDQNMQL BL:SWS:NREP 1 BL:SWS:REP 3->217|EXOS6_DANRE|1e-16|34.7|173/271| SEG 290->305|aveaaraaqaivleaa| BL:PDB:NREP 1 BL:PDB:REP 34->271|2po1A|2e-11|29.8|198/236| RP:PDB:NREP 1 RP:PDB:REP 39->288|2br2R|3e-23|27.0|196/245| HM:PFM:NREP 1 HM:PFM:REP 43->209|PF01138|1.3e-29|35.9|128/132|RNase_PH| RP:SCP:NREP 1 RP:SCP:REP 43->209|1e3hA3|6e-14|12.5|128/137|d.14.1.4| HM:SCP:REP 36->217|1oysA1|5.5e-08|30.1|143/151|d.14.1.4|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 102 OP:NHOMOORG 95 OP:PATTERN ------------------------------------------------------11------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------11111111111111111-111111-221111111-111111-111111111-11------1-1------1----11-11111111111--1111----2111111------------------------------------------111--111-13---11--1--------1121-1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 79.8 SQ:SECSTR ###############ccccccHHHHHHHHHHHTTccccccTTEEccEEEEEcccTTccEEEEEEETTETEEE#########ETTEEEEEEEEEEEEccGGGccccccEEEEEEEEcTTcccccccccccHHHHHHHHHHHHHHHTTccGGGcTTEEEEEEEEEEEcEccHHHHcHHcccHHHHHccHccHHHHHHHHHHHHHHHHHTTcccccccEEEEEEEccccccEEEEEEEEETTEcEEEcccHHHHHHccEEEEEEEEGGGTEEEEEccEEcccHHHHHHHHH########################################### DISOP:02AL 330-332| PSIPRED cccccccccccccccccHHHccccHHHHcccccccccccccccEEEEEEEEccccccccEEEEEEccccEEEEEEccccccccccEEEEEEEcccccccccccccEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEcccccEEEcccccccccEEEEcccHHHHHcccccEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccccccccc //