[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00325
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  45/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   172->294 3bk2A PDBj 2e-04 20.2 %
:RPS:SCOP  190->223 1gpmA1  c.26.2.1 * 6e-04 45.5 %
:RPS:PFM   102->197 PF09496 * Cenp-O 4e-23 63.6 %
:HMM:PFM   102->200 PF09496 * Cenp-O 5.5e-34 65.2 89/90  
:BLT:SWISS 113->202 CENPO_CHICK 2e-04 39.7 %
:COIL

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00325 GT:GENE CIRG_00325 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 300 SQ:AASEQ MEQTTPPEPNPSLVLDEEISKIRSEIQNLTKRRRVLSASLLSTNAVQSALGRQNASDSNPSLVPVVLDSQNHALSNHHRAVFSTTSFPFKDPSPHSRSQNLLGIRIDICTRGGRYSKPYYLLLERAHSDQTLLRVHRHTIPTFIPLNQLERKYLAVPDVDSELQQALKAKPGKQDLKRFVRQLRRELVAWHLRRDAIAWLREELGIDKVECVGDSQGSDSLAVKLGISSITPASLEARYLRFEWRDGRVGQIQLSSQGLVERAVVVSSEGRDMTTENLFLRGDRRIETAVQRLLDANMTG BL:SWS:NREP 1 BL:SWS:REP 113->202|CENPO_CHICK|2e-04|39.7|68/325| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 13->42| RP:PDB:NREP 1 RP:PDB:REP 172->294|3bk2A|2e-04|20.2|109/535| RP:PFM:NREP 1 RP:PFM:REP 102->197|PF09496|4e-23|63.6|88/92|Cenp-O| HM:PFM:NREP 1 HM:PFM:REP 102->200|PF09496|5.5e-34|65.2|89/90|Cenp-O| GO:PFM:NREP 5 GO:PFM GO:0000775|"GO:chromosome, centromeric region"|PF09496|IPR018464| GO:PFM GO:0005515|"GO:protein binding"|PF09496|IPR018464| GO:PFM GO:0005634|"GO:nucleus"|PF09496|IPR018464| GO:PFM GO:0007059|"GO:chromosome segregation"|PF09496|IPR018464| GO:PFM GO:0051301|"GO:cell division"|PF09496|IPR018464| RP:SCP:NREP 1 RP:SCP:REP 190->223|1gpmA1|6e-04|45.5|33/175|c.26.2.1| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------11111111-111111111111111111111111111111111-111------------------------------------------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 60.3 SQ:SECSTR #################################################################################################cccccGGGcEEEEETTTcHHHHTTTcccGGGTcccccEEEEE##EEccGGGHHHHHHHHHcTTcHHHHTTcTTccHHHHHHHHHHHcccEEEEccHHHHHHHHHHHTcccccEEEEEEccccEEEEETEEEEEcHHHHHHH##############HHHHHcEEEEEEEEccccEEEEEEEcccHHHHTcHHHHHHHH###### DISOP:02AL 300-301| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccHHHHHccccHHHHHHHHHcccccccccccccccccccEEEEEEEEEccccccccEEEEEEEccccccEEEEEEccccccccHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEccccccccccEEEEEEEcccccccccccEEEEEEccccEEEEEEcccccEEEEEEEEccccHHHHHHHHHcccHHHHHHHHHHHHccccc //