[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00377
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  0/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
d.66.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->156 1s1hD PDBj 9e-54 84.0 %
:RPS:PDB   47->151 1c05A PDBj 7e-15 29.7 %
:RPS:SCOP  4->150 1fjgD  d.66.1.2 * 8e-20 26.6 %
:HMM:SCOP  8->157 1fjgD_ d.66.1.2 * 9.3e-23 32.9 %
:RPS:PFM   101->142 PF01479 * S4 7e-04 42.9 %
:HMM:PFM   4->99 PF00163 * Ribosomal_S4 1.7e-23 35.6 90/94  
:HMM:PFM   100->143 PF01479 * S4 7.4e-17 45.5 44/48  
:BLT:SWISS 1->156 RS9_PODAN 2e-67 85.3 %
:PROS 98->122|PS00632|RIBOSOMAL_S4
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00377 GT:GENE CIRG_00377 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 185 SQ:AASEQ MAPRSYSKTYKVPRRPYESARLWSANMACVTSVRCGGVQLTLSKIRRAARELLTLEEKDPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTQVYRLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPLGGGRPGRVRRKKMKAAEKGDEEAEEEEE BL:SWS:NREP 1 BL:SWS:REP 1->156|RS9_PODAN|2e-67|85.3|156/190| PROS 98->122|PS00632|RIBOSOMAL_S4|PDOC00549| SEG 158->184|gggrpgrvrrkkmkaaekgdeeaeeee| BL:PDB:NREP 1 BL:PDB:REP 38->156|1s1hD|9e-54|84.0|119/178| RP:PDB:NREP 1 RP:PDB:REP 47->151|1c05A|7e-15|29.7|101/159| RP:PFM:NREP 1 RP:PFM:REP 101->142|PF01479|7e-04|42.9|42/46|S4| HM:PFM:NREP 2 HM:PFM:REP 4->99|PF00163|1.7e-23|35.6|90/94|Ribosomal_S4| HM:PFM:REP 100->143|PF01479|7.4e-17|45.5|44/48|S4| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF01479|IPR002942| RP:SCP:NREP 1 RP:SCP:REP 4->150|1fjgD|8e-20|26.6|143/208|d.66.1.2| HM:SCP:REP 8->157|1fjgD_|9.3e-23|32.9|143/208|d.66.1.2|1/1|Alpha-L RNA-binding motif| OP:NHOMO 354 OP:NHOMOORG 235 OP:PATTERN 111111-11111111111111111-111-11-11111111111111111111111111--11111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 111111115221222111111111111111111111111111111111111111111111-11-1111-12--21-2---1111--23-1211113111111132413212121143211321347-3-AA1-31111112111---1121--1---111-111131321211111111F1111164871221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 67.0 SQ:SECSTR #################################ccccccccccccccccHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHTTcccTHHHHHHHHHHHcHHHHHHHTTccccHHHHHHHHHTTcEEETTEEcccccccccTTcEEEEcGcccccc############################ DISOP:02AL 185-186| PSIPRED cccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccEEEccEEEccccEEEccccEEEEEEccccccccccccHHHHHHHccccccccccccccc //