[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00378
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  0/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
b.34.5d.68.7
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->100 1s1iQ PDBj 8e-40 71.1 %
:RPS:SCOP  3->113 1whrA  d.68.7.1 * 6e-21 15.1 %
:HMM:SCOP  2->100 1ffkN_ b.34.5.1 * 1.6e-33 52.6 %
:RPS:PFM   3->100 PF01157 * Ribosomal_L21e 2e-29 70.4 %
:RPS:PFM   80->128 PF00308 * Bac_DnaA 3e-04 28.6 %
:HMM:PFM   3->99 PF01157 * Ribosomal_L21e 2.2e-42 59.8 97/99  
:BLT:SWISS 1->160 RL21B_SCHPO 5e-57 65.6 %
:PROS 37->62|PS01171|RIBOSOMAL_L21E

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00378 GT:GENE CIRG_00378 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 160 SQ:AASEQ MGHSRGLRSGTRYAFSRDFKKHGTIAMSTYLKTYRVGDIVDIKVNGAVQKGMPFKVYHGKTGVVYNVTKSAVGVIIYKRVGNRYMEKRVNVRIEHVNHSRSREEFLNRVKENAIKKRKAKEEGIHVHLKRQPVVPRDARTVSTENNFPETIIPVPYETTI BL:SWS:NREP 1 BL:SWS:REP 1->160|RL21B_SCHPO|5e-57|65.6|160/160| PROS 37->62|PS01171|RIBOSOMAL_L21E|PDOC00901| BL:PDB:NREP 1 BL:PDB:REP 4->100|1s1iQ|8e-40|71.1|97/97| RP:PFM:NREP 2 RP:PFM:REP 3->100|PF01157|2e-29|70.4|98/99|Ribosomal_L21e| RP:PFM:REP 80->128|PF00308|3e-04|28.6|49/218|Bac_DnaA| HM:PFM:NREP 1 HM:PFM:REP 3->99|PF01157|2.2e-42|59.8|97/99|Ribosomal_L21e| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01157|IPR001147| GO:PFM GO:0005622|"GO:intracellular"|PF01157|IPR001147| GO:PFM GO:0005840|"GO:ribosome"|PF01157|IPR001147| GO:PFM GO:0006412|"GO:translation"|PF01157|IPR001147| RP:SCP:NREP 1 RP:SCP:REP 3->113|1whrA|6e-21|15.1|106/124|d.68.7.1| HM:SCP:REP 2->100|1ffkN_|1.6e-33|52.6|95/0|b.34.5.1|1/1|Translation proteins SH3-like domain| OP:NHOMO 497 OP:NHOMOORG 201 OP:PATTERN ---------------1----------------------1111111-1--------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1111111152211121111111111111111111111111111111111111111111111112211111122122222211111122-1211111111111143411212111211-2-1-D1Up2G2AlD-28L111391171111-18-222111112111111112311121111H1111142241411111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 60.6 SQ:SECSTR ###ccccccccTTcccccccccccccTTTTTcccccccEEcccccccccccccccccccccEEcccccccccccccccccccccccccccccTTcccccc############################################################ DISOP:02AL 160-161| PSIPRED cccccccccccHHHHcccHHHccccccHHcccEEccccEEEEEEcccEEccccccccccEEEEEEEEcccEEEEEEEEccccEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEccccccEEEccccccccc //