[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00384
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
d.58.7
:406 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   109->176 2qfjB PDBj 2e-05 36.9 %
:RPS:PDB   109->171 1cvjC PDBj 1e-08 23.3 %
:RPS:SCOP  109->192 1cvjA1  d.58.7.1 * 3e-09 20.5 %
:HMM:SCOP  72->172 1hl6A_ d.58.7.1 * 1.1e-11 26.3 %
:RPS:PFM   111->184 PF00076 * RRM_1 4e-04 33.8 %
:HMM:PFM   111->171 PF00076 * RRM_1 4.7e-09 29.8 57/70  
:BLT:SWISS 91->173 CPSF6_DROME 3e-07 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00384 GT:GENE CIRG_00384 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 406 SQ:AASEQ MATEDDNFDIDIYGDAGGYNGNENEGDYKVEEPELILDAPETSHQNGIGDGGASGGNNNATENGNHKIFKTEESGQPGKSASDNLQVPQQGVKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDRSRSSSAGFNSPVQGMNFGMGNTGGYRGGRGGGFNRGGMNMGGFNANRNFSNPMGSGGFQGGAMGGAGFQGTPVGGMQPYGGFGNRGGMMGSNMRGGPNMRGRGGMGGPMGGNMMPVGGMGGVGMGGMGMGGMGGMGGMPNQMGGMMGGMQGGMGMQGQGFQGQNPHFNPAFFGQHGGSDGAWNPHGAKRTRQE BL:SWS:NREP 1 BL:SWS:REP 91->173|CPSF6_DROME|3e-07|33.3|81/652| SEG 13->28|ygdaggyngnenegdy| SEG 46->65|ngigdggasggnnnatengn| SEG 229->262|nfgmgntggyrggrgggfnrggmnmggfnanrnf| SEG 266->283|mgsggfqggamggagfqg| SEG 293->377|ggfgnrggmmgsnmrggpnmrgrggmggpmggnmmpvggmggvgmggmgmggmggmggmpnqmggmmggmqggmgmqgqgfqgqn| BL:PDB:NREP 1 BL:PDB:REP 109->176|2qfjB|2e-05|36.9|65/194| RP:PDB:NREP 1 RP:PDB:REP 109->171|1cvjC|1e-08|23.3|60/168| RP:PFM:NREP 1 RP:PFM:REP 111->184|PF00076|4e-04|33.8|68/71|RRM_1| HM:PFM:NREP 1 HM:PFM:REP 111->171|PF00076|4.7e-09|29.8|57/70|RRM_1| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00076|IPR000504| RP:SCP:NREP 1 RP:SCP:REP 109->192|1cvjA1|3e-09|20.5|78/80|d.58.7.1| HM:SCP:REP 72->172|1hl6A_|1.1e-11|26.3|95/0|d.58.7.1|1/1|RNA-binding domain, RBD| OP:NHOMO 68 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------12111-11111111111111111121111111111111111111111111--------------------------1211111----1-1-11--------------------------------------------------------------------------------11-12-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 35.2 SQ:SECSTR #####################################################################################EccccEEEcTTccEEEETccHHHcEEEEEcccTTccHHHHHHHHGGGcHHHcEEEEEEEEcTTTccEEEEEEEEEccHHHHHHHHHTEEEEcTcEETTEEcEEEEccccTHHHHTcEEEEEcccTTccHHHHHHHHTccccEE################################################################################################################################################################################## PSIPRED ccccccccEEEEEEcccccccHHHHccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEccHHHHHHHHHHHHHHcccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //