[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00385
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  131/199 : Viruses  0/175   --->[See Alignment]
f.23.28
:70 amino acids
:PSIPRED
:RPS:SCOP  13->65 1rh5B  f.23.28.1 * 2e-15 32.0 %
:HMM:SCOP  3->67 1rhzB_ f.23.28.1 * 1.5e-11 30.8 %
:HMM:PFM   12->67 PF00584 * SecE 7.3e-15 17.9 56/57  
:BLT:SWISS 1->70 SC61G_NEUCR 2e-26 64.3 %
:PROS 15->43|PS01067|SECE_SEC61G
:TM

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00385 GT:GENE CIRG_00385 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 70 SQ:AASEQ MSETFQELADIPKDFVKDGMLFVNRCTKPDKREFLKISQAVGFGFLIMGAIGYFIKLIHIPVNNILVGGA BL:SWS:NREP 1 BL:SWS:REP 1->70|SC61G_NEUCR|2e-26|64.3|70/70| PROS 15->43|PS01067|SECE_SEC61G|PDOC00818| TM:NTM 1 TM:REGION 41->63| HM:PFM:NREP 1 HM:PFM:REP 12->67|PF00584|7.3e-15|17.9|56/57|SecE| RP:SCP:NREP 1 RP:SCP:REP 13->65|1rh5B|2e-15|32.0|50/56|f.23.28.1| HM:SCP:REP 3->67|1rhzB_|1.5e-11|30.8|65/65|f.23.28.1|1/1|Preprotein translocase SecE subunit| OP:NHOMO 148 OP:NHOMOORG 131 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 11-1111-1----11111111111--1111111111111111111111111111111111111--1---1---11-----11111111-1211111111111-122--1--1-12---1--1-142-1-412-111111-1-111----11-11-1---111--1113-1-21----------1-1---1--1112111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //