[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00393
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  421/915 : Eukaryota  103/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:363 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->360 1ys4A PDBj 5e-72 50.7 %
:RPS:PDB   8->355 1brmB PDBj 1e-22 16.8 %
:RPS:SCOP  8->143 1vknA1  c.2.1.3 * 2e-18 24.4 %
:RPS:SCOP  153->324 1brmA2  d.81.1.1 * 7e-14 31.9 %
:HMM:SCOP  6->181 2g17A1 c.2.1.3 * 2e-42 40.1 %
:HMM:SCOP  153->345 1brmA2 d.81.1.1 * 6.9e-38 36.4 %
:RPS:PFM   8->127 PF01118 * Semialdhyde_dh 4e-10 33.6 %
:RPS:PFM   166->328 PF02774 * Semialdhyde_dhC 6e-12 44.0 %
:HMM:PFM   165->343 PF02774 * Semialdhyde_dhC 6.1e-36 34.8 161/184  
:HMM:PFM   8->132 PF01118 * Semialdhyde_dh 1.1e-30 35.3 119/121  
:BLT:SWISS 6->363 DHAS_YEAST e-109 55.2 %

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00393 GT:GENE CIRG_00393 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 363 SQ:AASEQ MASVPKKKCGVLGATGSVGQRFVLLLADHPFLELHAVGASFRSAGKLYKDAVRWKQAKPISEKIANLLVRDCRSEHFKDCDLVFSGLDSDIAGEIEMEFIKADLPVFSNAKNYRRDPAVPLVVPTVNTSHLDLIPYQRKHYNLNKGFLVCNSNCAVIGIVIPFAALQAKFGPVEEVEVFTEQAISGAGYPGVPSMDIVDNVIPFISGEEDKLETEAQKILGTLNADATAFVEQEGLRVGATCTRVGVTDGHMAFVSLRFKNRPPPSAEQVAQAMREYQSEAQKLGCYSAPPQAIKVFDEPDRPQPRLDRDLSGGYTVSVGRIREGQKGGYFDIRFAALSHNTVIGAAGSSILNAEAAVIKGYL BL:SWS:NREP 1 BL:SWS:REP 6->363|DHAS_YEAST|e-109|55.2|355/365| BL:PDB:NREP 1 BL:PDB:REP 6->360|1ys4A|5e-72|50.7|335/338| RP:PDB:NREP 1 RP:PDB:REP 8->355|1brmB|1e-22|16.8|316/357| RP:PFM:NREP 2 RP:PFM:REP 8->127|PF01118|4e-10|33.6|113/120|Semialdhyde_dh| RP:PFM:REP 166->328|PF02774|6e-12|44.0|134/165|Semialdhyde_dhC| HM:PFM:NREP 2 HM:PFM:REP 165->343|PF02774|6.1e-36|34.8|161/184|Semialdhyde_dhC| HM:PFM:REP 8->132|PF01118|1.1e-30|35.3|119/121|Semialdhyde_dh| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01118|IPR000534| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01118|IPR000534| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF01118|IPR000534| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01118|IPR000534| GO:PFM GO:0005737|"GO:cytoplasm"|PF02774|IPR012280| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF02774|IPR012280| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF02774|IPR012280| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF02774|IPR012280| RP:SCP:NREP 2 RP:SCP:REP 8->143|1vknA1|2e-18|24.4|123/176|c.2.1.3| RP:SCP:REP 153->324|1brmA2|7e-14|31.9|144/210|d.81.1.1| HM:SCP:REP 6->181|2g17A1|2e-42|40.1|157/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 153->345|1brmA2|6.9e-38|36.4|165/0|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 622 OP:NHOMOORG 585 OP:PATTERN 11-1--2322222222-111111111111111111111111111111111111111111-211-1-11 111-1------1----------------------------------1-------------11-1-1-121-1111111111111111-1111-11----1-1111---1-111111111111111-1111--11-11111111111-11-111--111----111-1--111-11----11--1111111-1-111111-1--------1-1111-----11111-111111111111111111111111111-1-1111111-1211---1-111---1111---111-----------------------------1---111-22111111111111111---111-1-11-11-1-1-12--11-11-11-12111111111-1111111111111111111111-1111111111111111111111111111111111111111111111111111111---11111---11---1111111111-1--11111-----------------------------------------------------------------------1--1-11-1-11111------11-111111-211111-----1-1--------11-111---1--1111-1111111111111111111---------------------------------------------------------------------------------------------------11111111111---------------------------------------------------------11111-----11111---1-11---11111-11111111----------1-------------------------1111-1111111- ------------11111111111111111111111111111111111111112111111111111111111111111-1111111111-12111111111111111-11------------------------------------------------------------------11--D----1---31---1---11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 358 STR:RPRED 98.6 SQ:SECSTR #####cEEEEEEccccHHHHHHHHHHHHTTGGGGcEEEEEEcccTTcccccTTccccccccTccccEETTcHHHHHTccEEEEcccHHHHHHHHHHHHTTTcccEEEEcccTTTTcTTEEEEcHHHHHHHHHHHHHHHHHHHHTTccEEEEccHHHHHHHHHHHHHHTTTccEEEEEEEEEEcGGGTcHHHHHHHHHHHcccccTTTccccTTcccTTcHHHHHHHTHHHTccccccEEEEEEEcccccEEEEEEEEEEcccccccHHHHHHHHHHHHcTTcccHHcTTcccccccccHHHHHHHccHHHHTTcccccEEEEEEcTTcTTEEEEEEEEEETTcccccHHHHHHHHHHHHHTcc PSIPRED ccccccEEEEEEccccHHHHHHHHHHHcccccEEEEEEEEcHHccEEcccccccccccccccccccEEEEEccHHHHccccEEEEcccHHHHHHHHHHHHHcccEEEEccccccccccccEEEccccHHHHHHHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccHHHcccccccccccHHHHHHHHHHHHcccHHcccccccccccEEEEEEEEccccccEEEEEEEEEEccccccHHHHHHHHHHHccccccEEEcccccccEEEEccccccccccEEEEcccccEEEEEEEEcccccccEEEEEEEEEccHHHHHHHHHHHHHHHHHcccc //