[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00411
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  160/199 : Viruses  0/175   --->[See Alignment]
a.118.9a.216.1a.7.8
:1056 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->179 1hx8B PDBj 3e-04 31.5 %
:BLT:PDB   852->998 1r0dB PDBj 2e-25 43.2 %
:RPS:PDB   12->129 1eduA PDBj 4e-17 15.9 %
:RPS:PDB   878->999 2b0hA PDBj 2e-14 14.8 %
:RPS:SCOP  20->138 1hf8A2  a.118.9.3 * 9e-15 23.5 %
:RPS:SCOP  163->281 1hf8A1  a.7.8.2 * 3e-14 13.7 %
:RPS:SCOP  821->1008 1r0dA  a.216.1.1 * 9e-53 37.2 %
:HMM:SCOP  20->138 1hx8A2 a.118.9.3 * 1e-27 35.3 %
:HMM:SCOP  159->282 1hf8A1 a.7.8.2 * 0.00047 19.7 %
:HMM:SCOP  816->1009 1r0dA_ a.216.1.1 * 7.8e-58 52.1 %
:RPS:PFM   21->285 PF07651 * ANTH 3e-31 39.1 %
:RPS:PFM   452->615 PF09728 * Taxilin 6e-04 34.8 %
:RPS:PFM   862->1054 PF01608 * I_LWEQ 2e-42 61.1 %
:HMM:PFM   862->1054 PF01608 * I_LWEQ 2.8e-82 60.2 191/194  
:HMM:PFM   20->281 PF07651 * ANTH 3.6e-79 37.2 258/279  
:BLT:SWISS 17->288,397->1054 SLA2_SCHPO e-153 48.9 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00411 GT:GENE CIRG_00411 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 1056 SQ:AASEQ MSMAYNSTVTRNIDMSRTEADLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWAGMKVQPVLADEVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGPLIREYVFYLESKLAFHRQHPEFNGLFEYEEYISLKSINDPNEGYETITDLMALQDQIDAFQKLIFSHFRGGANNECRISALVPLVQESYGIYKFITSMLRAMHTTTGDEEALEPLRGRYDAQHYRLVRFYYECSNLRYLTSLITVPKLPQQPPNLLAEDEDRPALPKRPSKEVEKEPTPPPKSTIPDPEPINDFWSTEAKRQQEEYEAEQRRLQQQWEDQQRQQMLAQQQAQRDFEEQQRLQAEQQRLAQEQLLRDQYQQQTQGRLAELEQENLNARAQYERDQLLLQQYDKRVKDLEEQLNQLNSNYNLQNTSKDDQIRALQEQVNTWRSKYEALAKLYSQLRQEHLDLLQTTKSLKLKAASAQEAIDKRERLEREMKTKNLELADMIRERDRALHEKDRISGGNKEELEKVKRELRLAIERAENAERAKSSEISAMLSKYNREMADLEEALRNKNRALEEARNSTGERDHDHELTLREKDEEIEVYKSGMEQALMELEELKLNQGDVDKALDTQIDDVLLSSVTKINDIIDSVLQSGVQRVDDALYELDSTMQAGNQNASPPYVLSQIEKASASATEFSTAFNNFIADGPNSAHSEIIRTVSVFSGSIADVLSNTKGLTRFATDDKKADQLINAARQSAQSTMTFFRALQSFRLQDLEPLQKTDVVINNNHEVALNLQKLSKLVDAFAPKSTKLNGTGDLGDLVDRELSNAANAIEAAAARLAKLKKKPRDGYSTYELRIHDSILEASIAVTTAIAELIKAATASQQEIVREGRGSSSRTAFYKKNNRWTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKATFMSKTQDRLETASKAVGAACRALVRQVQAIIAEKNRDETEAVDYSKLSGHEFKVREMEQQVEILQLENKLSQARQRLGEMRKISYLE BL:SWS:NREP 1 BL:SWS:REP 17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092| COIL:NAA 284 COIL:NSEG 6 COIL:REGION 316->368| COIL:REGION 378->458| COIL:REGION 460->511| COIL:REGION 521->589| COIL:REGION 595->595| COIL:REGION 598->625| SEG 289->311|pskevekeptpppkstipdpepi| SEG 321->383|rqqeeyeaeqrrlqqqwedqqrqqmlaqqqaqrdfeeqqrlqaeqqrlaqeqllrdqyqqqtq| SEG 420->432|qlnqlnsnynlqn| SEG 527->539|keelekvkrelrl| SEG 693->704|asasatefstaf| SEG 832->850|naanaieaaaarlaklkkk| BL:PDB:NREP 2 BL:PDB:REP 22->179|1hx8B|3e-04|31.5|149/269| BL:PDB:REP 852->998|1r0dB|2e-25|43.2|146/186| RP:PDB:NREP 2 RP:PDB:REP 12->129|1eduA|4e-17|15.9|113/143| RP:PDB:REP 878->999|2b0hA|2e-14|14.8|122/137| RP:PFM:NREP 3 RP:PFM:REP 21->285|PF07651|3e-31|39.1|256/274|ANTH| RP:PFM:REP 452->615|PF09728|6e-04|34.8|141/294|Taxilin| RP:PFM:REP 862->1054|PF01608|2e-42|61.1|190/192|I_LWEQ| HM:PFM:NREP 2 HM:PFM:REP 862->1054|PF01608|2.8e-82|60.2|191/194|I_LWEQ| HM:PFM:REP 20->281|PF07651|3.6e-79|37.2|258/279|ANTH| GO:PFM:NREP 2 GO:PFM GO:0005543|"GO:phospholipid binding"|PF07651|IPR011417| GO:PFM GO:0003779|"GO:actin binding"|PF01608|IPR002558| RP:SCP:NREP 3 RP:SCP:REP 20->138|1hf8A2|9e-15|23.5|119/131|a.118.9.3| RP:SCP:REP 163->281|1hf8A1|3e-14|13.7|117/132|a.7.8.2| RP:SCP:REP 821->1008|1r0dA|9e-53|37.2|188/194|a.216.1.1| HM:SCP:REP 20->138|1hx8A2|1e-27|35.3|119/140|a.118.9.3|1/1|ENTH/VHS domain| HM:SCP:REP 159->282|1hf8A1|0.00047|19.7|122/132|a.7.8.2|1/1|GAT-like domain| HM:SCP:REP 816->1009|1r0dA_|7.8e-58|52.1|194/194|a.216.1.1|2/2|I/LWEQ domain| OP:NHOMO 405 OP:NHOMOORG 160 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----322-----22311111111111111111111211111111111111111211111111111-11111111121-1111112111-111111111111-1111-2--37769761422444882637U4354A243344356-43239227475332693222134322532------------1-1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 309 STR:RPRED 29.3 SQ:SECSTR ###########cccccccHHHHHHHHHHHTccccccccHHHHHHHHHTTcHHHHHHHHHHHHHHcccGGGHHHHHHHHHHHHHHHHHccHHHHHHHHHTHHHHGGGGcccccTTccccHHHHHHHHHHHHHHHHHHHHcccTTTcccc####cTTTcc####HHHHHHHHHHHHHHHHH################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################HTTccHHHHHHHHHHHH#HHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccTHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHHGGGcc####################################################### DISOP:02AL 1056-1057| PSIPRED ccccccccEEcHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccHHcccccccccccccccccccccccccccccccHHHcccccccccHHHccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //