[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00422
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
a.116.1
:668 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   57->248 2v0oC PDBj 2e-08 22.0 %
:BLT:PDB   464->665 1xa6A PDBj 3e-33 37.0 %
:RPS:PDB   57->329 2eflA PDBj 5e-20 15.2 %
:RPS:PDB   462->665 3byiD PDBj 7e-41 32.8 %
:RPS:SCOP  472->665 1xa6A1  a.116.1.1 * 7e-43 37.0 %
:HMM:SCOP  471->665 1xa6A1 a.116.1.1 * 8e-55 37.3 %
:RPS:PFM   57->139 PF00611 * FCH 3e-07 29.3 %
:RPS:PFM   489->636 PF00620 * RhoGAP 1e-24 39.9 %
:HMM:PFM   489->640 PF00620 * RhoGAP 2.8e-50 40.3 149/153  
:HMM:PFM   55->139 PF00611 * FCH 5.4e-18 31.0 84/91  
:HMM:PFM   117->197 PF02181 * FH2 0.00081 17.3 81/371  
:BLT:SWISS 47->363,450->668 RGD1_YEAST 1e-40 33.7 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00422 GT:GENE CIRG_00422 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 668 SQ:AASEQ MAEPTVNEASELTSPHQSLEMPAPPSPPDNEAEAPQAVPANQEEKEKLDRVILSDIGVVTLLNRLKQSISSAREFASFLRKRSSLEEDHAQGLKKLSRALHDSSMRSENRQGSFAQSYDEMNRIHDRMADHGLQFAVSLQQMSEDLNELAANMERGRKHWKQNGLNAEKRVQDAEAAAEKAKVKYDSLAEQYDRARTGDRQPGKFGLKGPKSAAQYEEDLLRKVQNADADYANKVQAAQTQKQELVATLRPQATRALQDLINECDSALTLQIQKFAAFSERLLLGSGLSVSPLKNEVNGNTAAPKSLRDAARQVDNERDFKDYILSHSSKVSSNATTIRYERHPTLITPQSQNASAHPKRQSLSINTAQTPPPQTAAQAFAQMTPHHPPPPPAQVQHAPQPQHAPPSFQHPHQEIFLTQPPVQHHPQPPYPTSAPPHQPYSPAHTRPSFSLDRAAPPTNAGHHPDLPPLNPVFGVSLEDLFLRDGTAIPMIVYQCIQAVELFGLNVEGIYRLSGNTLHIQRMKALFDNDSSKVDFTNPENFHHDVNSVAGLLKQFFRELPDPLFTNERYQDFINAARKDDDVQRRDTLHALINSLPDPNYATLRALILHLNHVQERASENRMNAGNIAISFGLTLMGSNAGHNIADSGWQARVIETVLQNTFQIFDDD BL:SWS:NREP 1 BL:SWS:REP 47->363,450->668|RGD1_YEAST|1e-40|33.7|518/666| COIL:NAA 37 COIL:NSEG 1 COIL:REGION 161->197| SEG 174->182|aeaaaekak| SEG 282->289|lllgsgls| SEG 367->413|taqtpppqtaaqafaqmtphhpppppaqvqhapqpqhappsfqhphq| SEG 419->431|qppvqhhpqppyp| BL:PDB:NREP 2 BL:PDB:REP 57->248|2v0oC|2e-08|22.0|186/272| BL:PDB:REP 464->665|1xa6A|3e-33|37.0|200/399| RP:PDB:NREP 2 RP:PDB:REP 57->329|2eflA|5e-20|15.2|250/273| RP:PDB:REP 462->665|3byiD|7e-41|32.8|201/209| RP:PFM:NREP 2 RP:PFM:REP 57->139|PF00611|3e-07|29.3|82/91|FCH| RP:PFM:REP 489->636|PF00620|1e-24|39.9|143/152|RhoGAP| HM:PFM:NREP 3 HM:PFM:REP 489->640|PF00620|2.8e-50|40.3|149/153|RhoGAP| HM:PFM:REP 55->139|PF00611|5.4e-18|31.0|84/91|FCH| HM:PFM:REP 117->197|PF02181|0.00081|17.3|81/371|FH2| GO:PFM:NREP 2 GO:PFM GO:0005622|"GO:intracellular"|PF00620|IPR000198| GO:PFM GO:0007165|"GO:signal transduction"|PF00620|IPR000198| RP:SCP:NREP 1 RP:SCP:REP 472->665|1xa6A1|7e-43|37.0|192/196|a.116.1.1| HM:SCP:REP 471->665|1xa6A1|8e-55|37.3|193/0|a.116.1.1|1/1|GTPase activation domain, GAP| OP:NHOMO 4128 OP:NHOMOORG 169 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----PNF-----87A4354555555454555454444445665555444554445544555555554534644355546653333364-7C737766566577MML-N1DU******aQSXYmc**V*J***K*s*TZWZ*Sn*jKjcaO*LJ*buiroGUcTLJQDWDGbIPLD-----------15151-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 487 STR:RPRED 72.9 SQ:SECSTR ########################################################cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH#####HHTccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHH##HHHHHHHHHHHHTTHHHH#######HHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHcc###############################################################################################################EEcHHHHHHHHHTTccccHHcHHHTTccccccTTccHHHHHHHHTccccHHHHHHHHHHHHHTTTcTTTTTccccHHHHHHHHHHHHTTcTcccccTTcGGGccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHTcccHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHTHHHHcccHHHHHHHHHHHHTccTTcccHHHHHHHHHHHHHHHHTHHHHHTcc PSIPRED cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHcccccccEEccccHHHHHHHHHHHHccccccccccHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccc //