[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00426
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  79/199 : Viruses  0/175   --->[See Alignment]
d.58.7
:346 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   191->282 2dngA PDBj 9e-05 25.6 %
:RPS:PDB   196->259 2dhxA PDBj 1e-08 13.1 %
:RPS:SCOP  196->260 1cvjA1  d.58.7.1 * 5e-09 18.5 %
:HMM:SCOP  131->273 1hl6A_ d.58.7.1 * 8.2e-15 16.7 %
:RPS:PFM   196->252 PF00076 * RRM_1 5e-04 29.8 %
:HMM:PFM   196->260 PF00076 * RRM_1 5.5e-15 26.6 64/70  
:BLT:SWISS 193->295 YGR4_SCHPO 7e-15 42.7 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00426 GT:GENE CIRG_00426 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 346 SQ:AASEQ MGDKRKRNQDAGDEDTVEVAEVKKLKKSAGDKEKKEKKSNKKEKKRAKDEHVDINGAESAEVNIEKSEKKKKEKKAKKQEKTENESTENSAQVAAAADINGEKEDKKERKEKKQKKEKKEKKEGKGKKDKKDKKEKKEKKAKAEDEAAKMELDEPDKMPEDATAPNNEAEEPAMEDAKEQEDDYIHPDRKEGRFIVFISNLPYSADYDSVSKHFAKLQPIQIRVPLERGGKKGRGFAFVEFSNYDRMKTCLKLYHHTMFDDGKSPSRKIGVELTAGGGGSKSETRKARIIEKNKKLNEERARAAKEAAKRKRIDEKKQEGQEAGGDDAQETNELADIHPSRRRRFQ BL:SWS:NREP 1 BL:SWS:REP 193->295|YGR4_SCHPO|7e-15|42.7|96/233| COIL:NAA 20 COIL:NSEG 1 COIL:REGION 294->313| SEG 23->50|kklkksagdkekkekksnkkekkrakde| SEG 65->85|eksekkkkekkakkqektene| SEG 101->149|gekedkkerkekkqkkekkekkegkgkkdkkdkkekkekkakaedeaak| SEG 159->177|pedatapnneaeepameda| SEG 298->317|eeraraakeaakrkridekk| BL:PDB:NREP 1 BL:PDB:REP 191->282|2dngA|9e-05|25.6|86/103| RP:PDB:NREP 1 RP:PDB:REP 196->259|2dhxA|1e-08|13.1|61/104| RP:PFM:NREP 1 RP:PFM:REP 196->252|PF00076|5e-04|29.8|57/71|RRM_1| HM:PFM:NREP 1 HM:PFM:REP 196->260|PF00076|5.5e-15|26.6|64/70|RRM_1| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00076|IPR000504| RP:SCP:NREP 1 RP:SCP:REP 196->260|1cvjA1|5e-09|18.5|65/80|d.58.7.1| HM:SCP:REP 131->273|1hl6A_|8.2e-15|16.7|138/0|d.58.7.1|1/1|RNA-binding domain, RBD| OP:NHOMO 81 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------1--------111111111111111111111121111111111111111-111-1111-1-1-11--111--------11111-11111111111----11-1---------------------------------------------------------1--------1--------------1-----111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 33.5 SQ:SECSTR #################################################################################################################################################################################EEcTTccEEEETccHHHHEEEEcccTTccHHHHHHHHHcTTTTcccEEEEEcEEEETTEEEEEEccHHHHHHHHTccccccccTTcETcccccEEEcccccccccccccccccccc##################################################### PSIPRED cccccccccccccccccHHHHHHHHHcccccccccccccHHHccccccccHHHHcccccccccccccccccccccHHHHHHHcccccccccccHHcccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEccHHHHHHHHHHHcHHHHHcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccHHcccccccccccccccHHHHHHcc //