[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00730
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:287 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  148->235 1j7lA_ d.144.1.6 * 1.3e-07 23.3 %
:HMM:PFM   165->217 PF01636 * APH 1.1e-08 30.2 53/238  
:HMM:PFM   208->233 PF08155 * NOGCT 0.00098 30.8 26/55  
:BLT:SWISS 47->97 PPID_SCHPO 3e-04 43.8 %
:BLT:SWISS 125->223 PK1_ASFK5 5e-04 30.3 %

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00730 GT:GENE CIRG_00730 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 287 SQ:AASEQ MDLSELKDDLYDLYRNRSSYWVRDIPYFKSSCSKILWKLGPVFTERETYGDDDIYKTYITETCGTCVATQVEGPSPGVQGIAKIRLQIPDDPENPSSTKPQRSSSRLAFEYYNHRTLTELGCTCIPKLLDYTLFTQKKGDPLPGGFLFILVMERLPGRNLVNFADLPMSERDQVRLAFAKSIREFYAFRFMHNDPDRRNLMWDPENKKCYIIDLEDAYQINDDEEPTKFMPEIHYREWGIAGPEINCHMYGLDPMVPHDRKFIKDPDDKTLERMAADSAGNQLVFGK BL:SWS:NREP 2 BL:SWS:REP 47->97|PPID_SCHPO|3e-04|43.8|48/356| BL:SWS:REP 125->223|PK1_ASFK5|5e-04|30.3|89/100| HM:PFM:NREP 2 HM:PFM:REP 165->217|PF01636|1.1e-08|30.2|53/238|APH| HM:PFM:REP 208->233|PF08155|0.00098|30.8|26/55|NOGCT| HM:SCP:REP 148->235|1j7lA_|1.3e-07|23.3|86/263|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 34 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1-------112111-2114525111111------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-45,48-48,109-110,115-116,118-118,123-123,129-129,137-137,151-151,157-158,160-160,165-166,171-172,174-174,179-179,193-193,199-200,202-202,227-227,230-230,235-235,287-288| PSIPRED ccHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccccEEEEEccccccccccEEEEEEEccccccccccccccccccEEEEEEccccHHHHHcHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEccHHccccccccHHHHcccccHHHHccccccEEEEEEcccccccccHHHHccccHHHHHHHHHcccccEEEEcc //