[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00734
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  91/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:588 amino acids
:PSIPRED
:RPS:SCOP  57->224 1pw4A  f.38.1.1 * 4e-05 12.3 %
:RPS:SCOP  377->503 1pv6A  f.38.1.2 * 5e-04 14.5 %
:HMM:SCOP  56->244 1pw4A_ f.38.1.1 * 4.3e-19 18.1 %
:HMM:SCOP  280->584 1pv7A_ f.38.1.2 * 1.2e-16 19.5 %
:RPS:PFM   119->514 PF06609 * TRI12 5e-09 22.3 %
:HMM:PFM   75->494 PF07690 * MFS_1 7.8e-21 17.1 345/353  
:BLT:SWISS 30->587 MIRB_EMENI e-100 36.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00734 GT:GENE CIRG_00734 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 588 SQ:AASEQ MRSPFGGSNRAAEAGTEKYQPDIEASDRENDNSDGIRSPTEAEDVSKEVQDGVRNMEAATSVWTKWHLIAAYVNIWLIYFVTSMQEVVLRSLNPYVTSSFSLHSLTAATTVMSSIIGGLSKIPLAKILDTWGRPQGLALTLFIWVIGYIMMAACKNVQTYAAAQVFSAVGSQGVSYCMTVFIADTSSLKNRSLMLAFATSPYVATTWVGGPISKSIIEVAGWRWGFGIFSIVVPVVVSPLCLIFLLNHRKAKKAGIVSTPGSGRKLNLQNIKKYAIDVDLVGVIILASGMALFLLPFSLWSFQAEKWKAPMIICMIIFGGLLLIFFTIYEKYLARVTFIPFNLLMDRTVFFAAVYFFFVFFCGAVWGGYFFSMLQVVWELDITNATYVSNIYRVGSCLWALVVGVLIRWTGRFKWLAVYFAVPLMMLGVGLMIHFRQPGVNIGYIVMTQIFVAFAGGTCVITGEMAMMAPSDHQHIAVIIAILNLFSSIGGAVGGTVSTAIWTSQFPAALHKHLPPGTDVSRIYASIITQLSYKPGTAIRDGISRAYGDAQRYMLITSVCLLAGALICAAAWRDIKLKDIKQVKGRVV BL:SWS:NREP 1 BL:SWS:REP 30->587|MIRB_EMENI|e-100|36.7|550/604| TM:NTM 12 TM:REGION 66->88| TM:REGION 134->156| TM:REGION 192->214| TM:REGION 227->248| TM:REGION 278->300| TM:REGION 310->332| TM:REGION 334->356| TM:REGION 360->382| TM:REGION 405->427| TM:REGION 443->465| TM:REGION 476->498| TM:REGION 553->575| SEG 225->239|gfgifsivvpvvvsp| SEG 349->361|vffaavyfffvff| SEG 560->571|cllagalicaaa| RP:PFM:NREP 1 RP:PFM:REP 119->514|PF06609|5e-09|22.3|368/526|TRI12| HM:PFM:NREP 1 HM:PFM:REP 75->494|PF07690|7.8e-21|17.1|345/353|MFS_1| RP:SCP:NREP 2 RP:SCP:REP 57->224|1pw4A|4e-05|12.3|163/434|f.38.1.1| RP:SCP:REP 377->503|1pv6A|5e-04|14.5|124/417|f.38.1.2| HM:SCP:REP 56->244|1pw4A_|4.3e-19|18.1|188/447|f.38.1.1|1/2|MFS general substrate transporter| HM:SCP:REP 280->584|1pv7A_|1.2e-16|19.5|256/417|f.38.1.2|2/2|MFS general substrate transporter| OP:NHOMO 544 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------33797C777HCGB5576778665666476534655ACENDCB475222D25-5921137325627812226344-21171817664413A44-----------------------------------------------------------------------------------5--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccc //