[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00738
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  320/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
b.33.1f.23.12
:245 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   62->243 3cx5E PDBj 2e-71 63.2 %
:RPS:PDB   64->245 3cwbE PDBj 6e-40 57.1 %
:RPS:SCOP  62->115 1ezvE2  f.23.12.1 * 5e-15 37.0 %
:RPS:SCOP  116->232 1ezvE1  b.33.1.1 * 1e-26 77.8 %
:HMM:SCOP  60->118 1bccE2 f.23.12.1 * 2.5e-17 42.4 %
:HMM:SCOP  104->244 1jm1A_ b.33.1.1 * 1.6e-39 39.6 %
:RPS:PFM   60->116 PF02921 * UCR_TM 5e-07 42.1 %
:RPS:PFM   175->226 PF00355 * Rieske 1e-06 46.2 %
:HMM:PFM   61->116 PF02921 * UCR_TM 1.9e-21 41.1 56/64  
:HMM:PFM   175->234 PF00355 * Rieske 4.9e-19 36.7 60/97  
:BLT:SWISS 36->245 UCRI_NEUCR 3e-84 68.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00738 GT:GENE CIRG_00738 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 245 SQ:AASEQ MPPLAASSASSLVRACARQNLALPRTLSVTASSQQLRAKSTAEAAPTSSFDSPFGRSKESASSLKIPSFKKYASPRNATTNKVFSYFVAGSMGLVSAVGAKATVQDFLVNMSASADVLAQAKVEISLASIPEGKNVIIKWRGKPVFIRHRTASEIAEAESTNWESLRDPQPDSDRVKKPEWLVMLGVCTHLGCVPIGEAGEFGGWFCPCHGSHYDISGRIRKGPAPLNLEVPQYDFPSEDTLVIG BL:SWS:NREP 1 BL:SWS:REP 36->245|UCRI_NEUCR|3e-84|68.1|207/231| SEG 5->11|aassass| BL:PDB:NREP 1 BL:PDB:REP 62->243|3cx5E|2e-71|63.2|182/185| RP:PDB:NREP 1 RP:PDB:REP 64->245|3cwbE|6e-40|57.1|182/196| RP:PFM:NREP 2 RP:PFM:REP 60->116|PF02921|5e-07|42.1|57/63|UCR_TM| RP:PFM:REP 175->226|PF00355|1e-06|46.2|52/95|Rieske| HM:PFM:NREP 2 HM:PFM:REP 61->116|PF02921|1.9e-21|41.1|56/64|UCR_TM| HM:PFM:REP 175->234|PF00355|4.9e-19|36.7|60/97|Rieske| GO:PFM:NREP 5 GO:PFM GO:0008121|"GO:ubiquinol-cytochrome-c reductase activity"|PF02921|IPR004192| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02921|IPR004192| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00355|IPR017941| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF00355|IPR017941| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00355|IPR017941| RP:SCP:NREP 2 RP:SCP:REP 62->115|1ezvE2|5e-15|37.0|54/56|f.23.12.1| RP:SCP:REP 116->232|1ezvE1|1e-26|77.8|117/129|b.33.1.1| HM:SCP:REP 60->118|1bccE2|2.5e-17|42.4|59/69|f.23.12.1|1/1|ISP transmembrane anchor| HM:SCP:REP 104->244|1jm1A_|1.6e-39|39.6|139/202|b.33.1.1|1/1|ISP domain| OP:NHOMO 598 OP:NHOMOORG 505 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------111----------------------------------------------------------121-11----------1-11-------11111--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1--1111122112322311111111111111111111121-11111131111111112111111111111111111-111-1221211111111111111111111111111111111111111111111111111121111111111111111121221221121111131-11111111111111121--------------------------------11111------11111111111-112211-111111111111111111111111111---1111------1-------------------------------------------------------------------------------------2-----1111111------------------------1111111111111111111------------11111111111111111111111111111111-------------------------------------------------------- 11--111-211-1121111111111111111111111111111111111111111111111111111111111111111111111111-13111111111111223-1413323221-111-1111121192-212-1-2111-11-1-111111111122111122212211121111D2111142221211121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 75.9 SQ:SECSTR ###########################################################cGGGccccccTTTccGcTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccccGGGccTTcEEEccccccccEEEEccHHHHTTTTcccTTcccccccTTcccccTTEEEEccccTTTccccEEcccccccEEETTTTEEEcTTccEEEcccccccccccEEEcccccEEEc PSIPRED ccccccccccHHHHHccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccEEEEEEccccEEEEcccHHHHHHHHcccHHHHcccccHHHHcccccEEEEEEEEccccccccccccccccEEccccccEEcccccEEcccccccccccEEEEccccEEEEc //