[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00758
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  107/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.26
:496 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   232->395 2aj4A PDBj 2e-07 11.1 %
:RPS:SCOP  232->271 1kvkA1  d.14.1.5 * 1e-05 17.9 %
:HMM:SCOP  8->331 1k47A1 d.14.1.5 * 4.7e-28 33.7 %
:HMM:SCOP  306->469 1kkhA2 d.58.26.3 * 4.4e-06 20.0 %
:HMM:PFM   199->263 PF00288 * GHMP_kinases_N 5.7e-17 47.4 57/68  
:HMM:PFM   378->452 PF08544 * GHMP_kinases_C 3.2e-09 25.4 63/82  
:HMM:PFM   355->390 PF05615 * THOC7 0.00019 33.3 36/139  
:BLT:SWISS 10->443 ERG8_YEAST 2e-41 34.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00758 GT:GENE CIRG_00758 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 496 SQ:AASEQ MPHEPPVETAVSAPGKVLLTGGYLVLDRNYTGTVLALNARIHVIVQQLPMGKGGRRTSASAGESPKGGLNVHADGDTPIDGMEGDVAKGKEHEEQSEEMIIVKSPQFIDAVWEYRIQRVESGGGVKVQQVNDGPQNPFVETSLNYALTYVSYVAASKHFGSLSVTILADNDYYSETATSSIPNRGGRFVNFGVKLQEAHKTGLGSSAALVTALVSAIVIHRTVQPEELPSVRDKLHNLAQAAHCAAQGKVGSGFDIAAAVYGSCLYRRFSPSVLSDLGEVGSPQFEQRLFTVVEDLNTEKPWDTECVDFGFKLPRGLQMILCDVDCGSQTPGMVKKVLEWREQNRGDAELLWTGLQRNNEKLRLELKRLAQNRNVVQNYDELSNLITRTRMWIKSMTKECGVPIEPEVQTELLNAFSKIDGVIGGVVPGAGGYDALMLLVKDDPAVMDAIHDLADGWKSSVQDDFGGKIGKVRLLGVGYGSEGLKNELAVRYSGWI BL:SWS:NREP 1 BL:SWS:REP 10->443|ERG8_YEAST|2e-41|34.2|383/451| SEG 202->219|glgssaalvtalvsaivi| SEG 421->432|gviggvvpgagg| RP:PDB:NREP 1 RP:PDB:REP 232->395|2aj4A|2e-07|11.1|135/509| HM:PFM:NREP 3 HM:PFM:REP 199->263|PF00288|5.7e-17|47.4|57/68|GHMP_kinases_N| HM:PFM:REP 378->452|PF08544|3.2e-09|25.4|63/82|GHMP_kinases_C| HM:PFM:REP 355->390|PF05615|0.00019|33.3|36/139|THOC7| RP:SCP:NREP 1 RP:SCP:REP 232->271|1kvkA1|1e-05|17.9|39/209|d.14.1.5| HM:SCP:REP 8->331|1k47A1|4.7e-28|33.7|193/194|d.14.1.5|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 306->469|1kkhA2|4.4e-06|20.0|135/0|d.58.26.3|1/1|GHMP Kinase, C-terminal domain| OP:NHOMO 112 OP:NHOMOORG 107 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11--211-11111111111111111111111111111111111111111111111111111111-11111111-1111111111--2111111111121111--11---------------------------------------------------------------------------11-2111-1-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 29.0 SQ:SECSTR ###################################################################################################################################################################################################################################ccccHHHHHHHHTTGGGGGTccccccHHHHHHHHccTTcEEEEE########################EEcccccEEEEEccccccccEEEEEEEEccccccTTTTTTTTHHHHHHHHHHHHHHHHHHTTccccccccHHHEHHHHHHHHHHcccccccccHHHHHHH##################################################################################################### DISOP:02AL 496-497| PSIPRED cccccccEEEEEccccEEEEEEEEEEcccccEEEEEEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccHHEEEEEEcccccccEEEEEEEcccccccEEEEHHHHHHHccccccccccccEEEEEEccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccEEEEEccHHHHHHHHccccccccHHHHcccccccccccccccEEccccccccccEEEEEEcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccccccEEEEEEccccHHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccccHHHHccccccccc //