[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00766
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  790/915 : Eukaryota  185/199 : Viruses  2/175   --->[See Alignment]
c.2.1
:372 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->358 1z45A PDBj e-105 58.5 %
:RPS:PDB   5->358 1a9zA PDBj 5e-45 48.2 %
:RPS:SCOP  6->349 1sb8A  c.2.1.2 * 2e-58 25.4 %
:HMM:SCOP  1->359 1gy8A_ c.2.1.2 * 2.7e-87 37.6 %
:RPS:PFM   6->267 PF01370 * Epimerase 2e-32 46.6 %
:HMM:PFM   6->283 PF01370 * Epimerase 6.7e-50 37.8 238/238  
:BLT:SWISS 6->358 GAL10_SCHPO e-119 62.2 %

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00766 GT:GENE CIRG_00766 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 372 SQ:AASEQ MAKGNVLVTGGMGYIGSFTSLALLEAGYSVVIADSLYNSSDEVLNRIELICGKRPGFFKLDVTDEAAFDRLFDENPSIDSVIHFAALKAVGESVERPLDYYNTNVYGTLCLLRSMVRHNVTNIVFSSSATVYGDATRFENMIPIPEECPLGPTNPYGNTKVIAETAITDVISSQRTNAIKAGNAEDAEKWNAALLRYFNPAGAHPSAIMGEDPQGVPYNLLPLLAQVATGKREKLLVFGDDYASHDGTAIRDYIHILDLANGHLEALNYLRDNRPGVRAWNLGTGKGSTVFDIIKAFSKAVGRDLPYEVVARRDGDVLDLTGNPSRANRELGWKATRTLEQACEDLWRWTKNNPQGYRQSPPEEFLAKLKQN BL:SWS:NREP 1 BL:SWS:REP 6->358|GAL10_SCHPO|e-119|62.2|339/713| BL:PDB:NREP 1 BL:PDB:REP 6->358|1z45A|e-105|58.5|325/674| RP:PDB:NREP 1 RP:PDB:REP 5->358|1a9zA|5e-45|48.2|336/338| RP:PFM:NREP 1 RP:PFM:REP 6->267|PF01370|2e-32|46.6|219/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 6->283|PF01370|6.7e-50|37.8|238/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 6->349|1sb8A|2e-58|25.4|311/341|c.2.1.2| HM:SCP:REP 1->359|1gy8A_|2.7e-87|37.6|343/383|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 2699 OP:NHOMOORG 1038 OP:PATTERN 112-1-11----11112312112233323532224224131222236244453133322331212-11 2362612222311113233-31223433332212222223156614111332434112112121444736211112222112335644532214221--32223232361--------------11222352333346677-11324525663111142323214324462232232342233212111141234444457424655663555324473412332111211362111111111111113---141113222313341122222122211122122233334424224323-------------221443111-31-634444554434314422224141-42122235444223212121213635335-----338543323333722222222213-21261223272134417944669722223223575522-2222222211223454-------------------------1-2-12321-155312224112333333542332322142111--22161122112411222311112112212122342221455357255544555434393442342544331213323331211111111-2-121544322332121243322222223322113--13333------13234321112112122-1211122211111--11-1522223233223333232123231512111122-212212212111--1-333331111123331111111111111114222213113321-21235-13331231212222222224234111112313333232332331222--63223366--------1-1----------1-1---13-1-----1132321211253 --11213-212135511342352343211211111111111111113322556412223333311-11-1-11-111-1111112133-12111212122121323-1A1321222222-112242132A73-333122-212211211-2112122237A736122222K33533244e84532GCJH3G66642532 -----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 372 STR:RPRED 100.0 SQ:SECSTR TcTTEEEEETTTcHHHHHHHHHHHHTTcEEEEEEccccccTTHHHHHHHHHTcccEEEEEccTTcHHHHHHHHHHTTccEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEGGGGccccccccccccTTccccccccHHHHHHHHHHHHHHHHTHHHTccHHHHHHHHHcTTcEEEEEEEcEEEcccTTcccccccccccccHHHHHHHHHTTccccEEEEcccccccccccEEcEEEHHHHHHHHHHHHHHHHTTccEEEEEEEcccccEEHHHHHHHHHHHHTccccEEEEcccTTcccccccccHHHHHHHcccccccHHHHHHHHHHHHHHcTTcccHHHHcGGGGHHHHH DISOP:02AL 372-373| PSIPRED ccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEHHHHHHHHHHHHcccccEEEcccccccccEEcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcc //