[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00775
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  397/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:238 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   45->219 1uj2A PDBj 5e-46 44.6 %
:RPS:PDB   41->216 1a7jA PDBj 1e-23 18.9 %
:RPS:SCOP  41->216 1a7jA  c.37.1.6 * 5e-24 18.9 %
:HMM:SCOP  15->211 1esmA_ c.37.1.6 * 2.9e-48 37.6 %
:RPS:PFM   34->197 PF00485 * PRK 2e-37 44.8 %
:HMM:PFM   17->204 PF00485 * PRK 3.2e-58 35.3 187/194  
:BLT:SWISS 35->224 URK1_SCHPO 1e-52 51.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00775 GT:GENE CIRG_00775 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 238 SQ:AASEQ MAETKSRCSRPWEDMSIIGIAGSSGSGKSSVAAEIIKSLNLPGAVILVMDHFYKSLTPEQNAIAHQDEYDFDSPDAIDFDVLVQTLQNLKQGLKVEIPIYSFTKHQREEATVSLYPPRVLILEGILAFTDPRIVDMLDIKIFVEADMDVCLGRRIARDVRERGRTLESVLKQWFKFVKPSYNRFVEPQRQISDIIVPRGIENKTAIDMVVKHIHRIITGAAQRHNPETRPNYHRRLSH BL:SWS:NREP 1 BL:SWS:REP 35->224|URK1_SCHPO|1e-52|51.6|190/454| SEG 16->33|siigiagssgsgkssvaa| BL:PDB:NREP 1 BL:PDB:REP 45->219|1uj2A|5e-46|44.6|175/213| RP:PDB:NREP 1 RP:PDB:REP 41->216|1a7jA|1e-23|18.9|175/279| RP:PFM:NREP 1 RP:PFM:REP 34->197|PF00485|2e-37|44.8|163/189|PRK| HM:PFM:NREP 1 HM:PFM:REP 17->204|PF00485|3.2e-58|35.3|187/194|PRK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00485|IPR006083| GO:PFM GO:0008152|"GO:metabolic process"|PF00485|IPR006083| GO:PFM GO:0016301|"GO:kinase activity"|PF00485|IPR006083| RP:SCP:NREP 1 RP:SCP:REP 41->216|1a7jA|5e-24|18.9|175/279|c.37.1.6| HM:SCP:REP 15->211|1esmA_|2.9e-48|37.6|194/311|c.37.1.6|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 922 OP:NHOMOORG 590 OP:PATTERN -------------------------111--1------------11-1-1------------------- 111-------------------------------------------------------------------------------------1111-111---111111--111----------1111------------111-----1-21121111111------11112221------------1111111--1111111111111111111111111111111111111111111111111111111111111111211211111111111111-111111111111111111111111111111111121111111111111-11-11212222111----111111-111---------11-------2-11--------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------------1--------------2---------------------------1------------------------------1111--111111111111111111111111-------------1111-111111111111-1111111111111111111111111111111111111111111111111111-111111111111----111111111--1-1111111111111111-----------------------------111111111-11111111111111------------------------11111111--1----1---1--11----1-1--11111-11-1---1-- --11441-31----2111111111111111111111-111111111-111111111111111112111121121211-1112211211-111111111111-1213-24149958832323233473439S3-5461323333321333131243343348724222622323222443a33344879A1B72211111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 75.2 SQ:SECSTR ########################################TccEEEEEGGGGccccHHHHHHHHTcTTccTTcGGGccHHHHHHHHHHHHHHcccEEccccccccccTccEEccccccEEEEEEccTTcccccGGGccEEEEEEEcHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHTGGGGGTccEEEEEEEccccccGGGccccccGHHc################### PSIPRED ccHHHHHccccccccEEEEEEccccccHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHccccEEEEEEEccccccccccEEEccccEEEEEcHHHHccHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccHHHHcc //