[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_00890
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
:287 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   180->264 PF04140 * ICMT 3e-06 37.3 %
:HMM:PFM   174->266 PF04140 * ICMT 6.2e-31 36.7 90/94  
:BLT:SWISS 95->286 STE14_YEAST 1e-44 48.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_00890 GT:GENE CIRG_00890 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 287 SQ:AASEQ MDSVASFPSRFSPLDEFPTPGLDGQPRPDYRPYRPTANGSTKSRVIDPAYLPGGEKSLSGISIRSFLLGQAAGTCVVLTVLLYTFSNPLWRVPFFVTSLALFHFLEYYITARYNNLFATVTAFLLTQNGAAYNIAHGSAVAECLLAHLFLPDGYFEWTAAIFGGIKYQVLVGLVLMVVGQIVRSLAMAQAGVSFTHTIQHHRREEHSLVKEGIYSIFRHPSYFGFFWWGLGTQLVLGNAVCFLGYAAVLWEFFSSRIRKEEMLLIEFFGKEYVEYRSKTWVGIPGIR BL:SWS:NREP 1 BL:SWS:REP 95->286|STE14_YEAST|1e-44|48.7|187/239| TM:NTM 5 TM:REGION 60->82| TM:REGION 90->111| TM:REGION 140->162| TM:REGION 169->190| TM:REGION 231->253| SEG 169->179|vlvglvlmvvg| RP:PFM:NREP 1 RP:PFM:REP 180->264|PF04140|3e-06|37.3|83/95|ICMT| HM:PFM:NREP 1 HM:PFM:REP 174->266|PF04140|6.2e-31|36.7|90/94|ICMT| GO:PFM:NREP 3 GO:PFM GO:0004671|"GO:protein-S-isoprenylcysteine O-methyltransferase activity"|PF04140|IPR007269| GO:PFM GO:0006481|"GO:C-terminal protein amino acid methylation"|PF04140|IPR007269| GO:PFM GO:0016021|"GO:integral to membrane"|PF04140|IPR007269| OP:NHOMO 210 OP:NHOMOORG 180 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1---211-211111111111111111111-1111111111111111--111111-111-1--12211112112111111112-22211-1-111111111121111-11111212111-1111111111131-111111111111-111111-112111121111111111122111117111-1111212111-2211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-31,287-288| PSIPRED cccHHHcHHccccHHHccccccccccccccccccccccccHHHHcccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccEEEccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //