[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01200
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  28/915 : Eukaryota  155/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:421 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   47->225 2d33D PDBj 9e-05 8.6 %
:RPS:SCOP  17->390 1pw4A  f.38.1.1 * 1e-15 11.7 %
:HMM:SCOP  1->417 1pw4A_ f.38.1.1 * 2.2e-60 25.1 %
:RPS:PFM   94->310 PF07690 * MFS_1 2e-07 30.8 %
:HMM:PFM   45->322 PF07690 * MFS_1 5.4e-27 23.8 273/353  
:HMM:PFM   280->410 PF07690 * MFS_1 1e-06 23.3 129/353  
:BLT:SWISS 2->414 MCH5_YEAST 7e-46 30.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01202 GT:GENE CIRG_01200 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 421 SQ:AASEQ MSDTPDSKNEVSSASIAAEEKSDAVPTFPDGGLKAWLAVAGAFSTMFCTFGYLSTFGVLESYYFSNLLRGSSHSEIAWIGSLQAFFMCTTGLVSGPLVDRYGTKMVLIPFSLLYVTSVMLTSLCKEYYQFLLAQGILGGFGIGMLYTPAISILGHYFQEKRDLAIGISSAGSPLGGIIFPIALNRFLRHTDIGFPWSVRIIGFIMLVLLSIACATLVPRISPRKGPHFLPAAFKKPVYSLQVVGYSVIFWGIYTPFFFLPAYATSHGVDVDWAFYIMPIYNSGSFVGRIVGSRLTFYLGRFNTLIGAIFISGILEFCWLATSNLGGLVTFAVLFGISSGAIIGLFPTTVAMTAPQANQIGTYLGMMMGALGVFCLTGSPMMGAIVSSSGFKPAIAFSAALTMLGGIMILVARIFHSKEIVA BL:SWS:NREP 1 BL:SWS:REP 2->414|MCH5_YEAST|7e-46|30.8|399/521| TM:NTM 12 TM:REGION 35->57| TM:REGION 76->98| TM:REGION 103->125| TM:REGION 132->154| TM:REGION 163->185| TM:REGION 194->216| TM:REGION 240->262| TM:REGION 267->289| TM:REGION 300->322| TM:REGION 331->353| TM:REGION 363->385| TM:REGION 396->418| RP:PDB:NREP 1 RP:PDB:REP 47->225|2d33D|9e-05|8.6|175/499| RP:PFM:NREP 1 RP:PFM:REP 94->310|PF07690|2e-07|30.8|214/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 45->322|PF07690|5.4e-27|23.8|273/353|MFS_1| HM:PFM:REP 280->410|PF07690|1e-06|23.3|129/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 17->390|1pw4A|1e-15|11.7|367/434|f.38.1.1| HM:SCP:REP 1->417|1pw4A_|2.2e-60|25.1|399/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1809 OP:NHOMOORG 191 OP:PATTERN --------11111----------1-------------------------------1---1-------- --------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11--------------------------------------------------------------------------------------------------------------------------1-1-------------------------11----------------------1------------------------------------------11-----------------------------------------------------------------1-------1111-1-----11--------------------1------111------------------------------1-----------------------1--------------------------------------------------------------------------1---------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------551IJSDMMOKcccWBB9977MKIACCCCCC867F6PULRcUKIBD96779493E6485263923133366679---7WIJAEC7575616D6D----eEMGBF86463276C91A5IdB-89B533-D489839443933E3CBB62223bK66CB8U88O1--------------H--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 41.6 SQ:SECSTR ##############################################HHHHTTHHHHHHccccEEEGGGcccccEEcTTcEEEcTTcccGG###GcTTcccccTTccccccHHHHHHHHHHHHHcc#cHHHHTTccEETTEEccccccccccGGGcccEEEEccccTTccHHHHHHHHcccEEEEEEEEccTTcTTcccHHHHHHHHHHHHHHHHcccccccHHHH#################################################################################################################################################################################################### PSIPRED cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //