[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01239
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  663/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.36.1c.48.1
:388 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   57->388 1olsB PDBj 2e-98 50.9 %
:RPS:PDB   56->388 2bfcB PDBj 1e-64 53.2 %
:RPS:SCOP  62->250 1dtwB1  c.36.1.7 * 7e-48 64.7 %
:RPS:SCOP  251->388 1dtwB2  c.48.1.2 * 9e-29 39.9 %
:HMM:SCOP  61->267 1qs0B1 c.36.1.7 * 1.3e-64 48.3 %
:HMM:SCOP  251->388 1dtwB2 c.48.1.2 * 6.3e-37 37.0 %
:RPS:PFM   82->242 PF02779 * Transket_pyr 4e-18 40.1 %
:RPS:PFM   261->374 PF02780 * Transketolase_C 3e-16 38.1 %
:HMM:PFM   65->241 PF02779 * Transket_pyr 2.2e-49 36.0 172/178  
:HMM:PFM   258->359 PF02780 * Transketolase_C 2.1e-32 46.5 101/124  
:BLT:SWISS 46->388 ODBB_RAT e-100 51.3 %

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01241 GT:GENE CIRG_01239 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 388 SQ:AASEQ MASPRHASRRLLGSLGSCRAYSSQAAPGARLNLPVDYKSTPLLHHASSTLSNNPELPQNASTKRLNLYQSINSALRTALAADERVLLFGEDVAFGGVFRCSVDLQTEFGSERVFNTPLTEQGIVGFGIGAAAEGFKPVAEIQFADYVFPAFDQLVNEAAKFRFREGATGGNIGGLVVRMPCGAVGHGALYHSQSPESLFTHVPGLRVVIPRSPTQAKGLLLNAILNCKDPVVFMEPKILYRAAVEYVPTEPYYLPLDKADIVKPGKDLTVISYGQPMYLCSDAIAKAEKDFGASIELIDLRAIYPWDRETVLESVRKTGRAIVVHESMMNAGVGAEVAATIQEGAFLRLEAPVKRVTGWGTHCGLIFEKFNLPDVARIYDAIKQTLHY BL:SWS:NREP 1 BL:SWS:REP 46->388|ODBB_RAT|e-100|51.3|341/390| BL:PDB:NREP 1 BL:PDB:REP 57->388|1olsB|2e-98|50.9|330/336| RP:PDB:NREP 1 RP:PDB:REP 56->388|2bfcB|1e-64|53.2|331/332| RP:PFM:NREP 2 RP:PFM:REP 82->242|PF02779|4e-18|40.1|152/172|Transket_pyr| RP:PFM:REP 261->374|PF02780|3e-16|38.1|113/122|Transketolase_C| HM:PFM:NREP 2 HM:PFM:REP 65->241|PF02779|2.2e-49|36.0|172/178|Transket_pyr| HM:PFM:REP 258->359|PF02780|2.1e-32|46.5|101/124|Transketolase_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02780|IPR005476| GO:PFM GO:0008152|"GO:metabolic process"|PF02780|IPR005476| RP:SCP:NREP 2 RP:SCP:REP 62->250|1dtwB1|7e-48|64.7|187/188|c.36.1.7| RP:SCP:REP 251->388|1dtwB2|9e-29|39.9|138/138|c.48.1.2| HM:SCP:REP 61->267|1qs0B1|1.3e-64|48.3|203/204|c.36.1.7|1/1|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 251->388|1dtwB2|6.3e-37|37.0|138/138|c.48.1.2|1/1|TK C-terminal domain-like| OP:NHOMO 1786 OP:NHOMOORG 887 OP:PATTERN 11-1--2133233231-1111---2111-111-----------------------1---12222--11 11314-------1-22211-1---32111111333324643325122211114352241144312272322---------1-511-21221212--2113233445423322222222222222121--1-1-1314552211-2422222222122111222112422311122311212112212211-32433333333233333335445333346523432223235222222222222222223332211-22-1--1111111111111111111111112211111-111111111111111111211111111121--11111111-1-13111-----1--31111112-11112-22323-131-411211111223112112112144443343343-11111211231132223364334333212326222223322222222133112111111111111--11111111111111111-25C41-21212222321111111141111-32122221--211-1-----3441--21--1-1-------11-23112313111-11--1-42424452411112213----------------------1112211111-221222211122111122111233---31--1--111------1-------------------------------11--221-----------------------------------------32222222221-2-1---11--1111111-11111-1---3-3333121112232--1--------------1-----11-112211111222------11332222----------111111-1-11111111111111------1-11121221 22--222-622-22222222222222222222222222222222222223223222222222211111111111111-1111111111-22222222222211222126242422212222222431318K3-4352222222332222222242333424523224721F32223342U2223355A62563442223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 335 STR:RPRED 86.3 SQ:SECSTR #####################################################ccccccccEEEEcHHHHHHHHHHHHHHHcTTcEEEETTTTTTcTTcTTTTHHHHHcTTTEEEccccHHHHHHHHHHHHHTTccEEEEcccGGGcGGGHHHHHTTGGGHHHHTTTTccccTTEEEEEEEccccccHHHHcccTHHHHHTcTTcEEEccccHHHHHHHHHHHHHHccccEEEEEEGGGTTcccEEEEcccccccTTccEEEEccccEEEEEcTTHHHHHHHHHHHHHHHHcccEEEEEccEEEcccHHHHHHHHHHHccEEEEEEEEcTTcHHHHHHHHHHHHHGGGcccccEEEEEcccccccTTHHHHcccHHHHHHHHHHHHTc PSIPRED ccccHHHHHHHHHHHHHHHHccccccccccHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHccccEEEccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccccccccHHHHHHHcccccEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccEEEccccccccccccEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEHHHcccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHcccccHHHHHHHHHHHHcc //