[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01242
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  86/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:759 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   157->365 3bp1B PDBj 7e-19 14.1 %
:RPS:SCOP  230->365 2ooxE1  d.37.1.1 * 1e-14 8.2 %
:HMM:SCOP  247->312 1yavA1 d.37.1.1 * 0.00038 36.5 %
:HMM:SCOP  314->376 1vr9A1 d.37.1.1 * 0.00061 26.7 %
:RPS:PFM   94->201 PF01595 * DUF21 1e-11 40.6 %
:HMM:PFM   57->225 PF01595 * DUF21 1.6e-39 30.1 163/183  
:HMM:PFM   329->373 PF00571 * CBS 0.0008 17.1 41/57  
:BLT:SWISS 76->538 MAM3_YEAST e-118 50.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01244 GT:GENE CIRG_01242 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 759 SQ:AASEQ MSSNHHAVRRYFGLGLIKLLLPLLARLPIVTGLPIFSPALATQEDGEPVNQPSFWLYLGVATALVVAGGAFAGLTIALMGQDEIYLQVIKTSGEGAEKRHAEKVLNLLKKGKHWVLVTLLLSNVITNETLPIVLDRSLGGGWPAVLGSTALIVVFGEVVPQSICVRYGLPIGAWMAPCVLILMYIMSPVAWPIAKLLDKLLGVDHRTLYKKAGLKTLVTLHKTLGSAGEQLNSDEVTIISAVLDLKEKPVGSIMIPMEDVFTMSTETVLDEKMMDLILSQGYSRIPIHSPDNPQNFVGMLLVKMLITYDPEDCKQVRDFALATLPETRAETSCLDIVNFFQEGKSHMVLVSEFPGEDHGALGVVTLEDVIEELIGEEIIDESDVFIDVHKAIRRMAPAPKARVPKGQIVTDPPDNLGALQNGDSEAASTGHKGPDASSSGTGDLQASRRKGSIGDIGSPPPPIFKLRKSSTHDAVEGPDAAIIQRGATPEIREHLKHLGPSNLASRPRQTRYNNVKIKPGSSSPLVSAVDSRLQSPDPQRRMSEVTSFSGNTGPGGGVKSAGKSASDAVLALRRYGSTTEAPSRRSITRDTVPTMNRDIINVRSDLLQPAPHRPSYRQGCLSPSEAPTLSAGGTTNSSPLSPPYLAHGPARSGSITEQVVDSNGIRKVILQTSDTHPASGEEGKGHSRQPSATQRSLYLLMLLSSTIAMTKTVKTKLIFLRVPRNKTRRRRREEERKGSQRAPNQVMERWMKDNPCWGD BL:SWS:NREP 1 BL:SWS:REP 76->538|MAM3_YEAST|e-118|50.5|444/706| TM:NTM 5 TM:REGION 15->37| TM:REGION 57->79| TM:REGION 112->134| TM:REGION 138->160| TM:REGION 168->190| SEG 14->27|lgliklllpllarl| SEG 58->75|lgvatalvvaggafaglt| SEG 366->381|ledvieeligeeiide| SEG 451->463|gsigdigsppppi| SEG 553->569|gpgggvksagksasdav| SEG 728->736|rrrrreeer| RP:PDB:NREP 1 RP:PDB:REP 157->365|3bp1B|7e-19|14.1|199/250| RP:PFM:NREP 1 RP:PFM:REP 94->201|PF01595|1e-11|40.6|106/184|DUF21| HM:PFM:NREP 2 HM:PFM:REP 57->225|PF01595|1.6e-39|30.1|163/183|DUF21| HM:PFM:REP 329->373|PF00571|0.0008|17.1|41/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 230->365|2ooxE1|1e-14|8.2|134/179|d.37.1.1| HM:SCP:REP 247->312|1yavA1|0.00038|36.5|63/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 314->376|1vr9A1|0.00061|26.7|60/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 585 OP:NHOMOORG 284 OP:PATTERN -----------------------------1-------------1-----1111--------------1 --1--------------------------------------1---------------------------------111-------2---------------1-1-----1-------1-1------------------------1--------11---------1----------------1--1------------------------1--------11---21--------1---------------11-------------------1-----111-11----1--11111111111-------------111111111----------1-------111----------------------------------11-----------------------------1----------------1-------------------------------------1----11-----11-------------111----------------------------------------------------------1-1-1-------------------11---11----------------------------------------------11-----------1-----11--------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1----------------11----------------------------11-------- 1122112-B52111111112111111111111111111111211111111111111111111111111-11111111-1111111111-34213232221142445-2224766565144214167384BP6174A142362443-323122-74144532-3133221125521354161112472371752223445 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 201 STR:RPRED 26.5 SQ:SECSTR ############################################################################################################################################################cEEETHH#HHHHTTcccEEEE####EEEEEcTTccEEEEEEEEEEETTccEEEcHHHHHHHHTTTTcHHHHHHHHHHHTcccEEEEEEGGGGTTcccccccEEccccccccccccHccGGGGTTcEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEcHHHHTTTTccccHHHHHHHHHHHHHHTcccEEEEEEEEc###ccTTEEEEEE########################################################################################################################################################################################################################################################################################################################################################################################################## DISOP:02AL 759-760| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHcccccHHHHHHHHHHHccccEEEHHEEEEHHHEEEccccccHHHHHHHHHHHccccEEEEEEccccccEEEEEEHHHHHHHHHcccccHHHHHHccccEEcccccHHHHHHHHHHcccEEEEEEEcccccccEEccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccHHHcccccccHHHccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccEEEcccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHEEEEEEEEccccHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccc //