[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01250
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  523/915 : Eukaryota  149/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:286 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   5->278 1lsjA PDBj 7e-26 31.0 %
:RPS:PDB   91->281 1e9yA PDBj 9e-29 12.8 %
:RPS:SCOP  2->177 1pgjA2  c.2.1.6 * 5e-08 10.8 %
:RPS:SCOP  182->278 1f0yA1  a.100.1.3 * 1e-27 37.1 %
:HMM:SCOP  1->180 1f0yA2 c.2.1.6 * 1.2e-31 34.3 %
:HMM:SCOP  182->279 1f0yA1 a.100.1.3 * 6.2e-27 46.9 %
:RPS:PFM   5->177 PF02737 * 3HCDH_N 1e-16 31.8 %
:RPS:PFM   182->276 PF00725 * 3HCDH 3e-18 48.4 %
:HMM:PFM   5->177 PF02737 * 3HCDH_N 1.5e-32 33.5 170/180  
:HMM:PFM   182->278 PF00725 * 3HCDH 1.3e-26 48.5 97/97  
:BLT:SWISS 5->278 HBD_CLOAB 1e-26 32.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01252 GT:GENE CIRG_01250 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 286 SQ:AASEQ MSAPVAILGAGTQGRRLAYMWSSRGRPVHLIDENLSQLQDAQKAVEQFRKTDSKSEYLSGELKTFASEDLRAALQEAWLVVECVPELLPLKRAVIENIDALTGPMTIIASNSSSFTITEIVAGLELRHPDRFVSLHSYWPPETPAIEIMASPKTKPLIIQRLISECKDHGFSPYHVKKNSTGYIYNRIWAAIKREALSVAAEGVATPEEIDAIYKDVLKTPKGPFEQMDVVGLDVVLDIEEHYAQERTGLPETPRELLRKMVAAGKLGVKSRQGFYTYDGEGRTEK BL:SWS:NREP 1 BL:SWS:REP 5->278|HBD_CLOAB|1e-26|32.1|262/282| SEG 79->90|lvvecvpellpl| BL:PDB:NREP 1 BL:PDB:REP 5->278|1lsjA|7e-26|31.0|271/291| RP:PDB:NREP 1 RP:PDB:REP 91->281|1e9yA|9e-29|12.8|180/238| RP:PFM:NREP 2 RP:PFM:REP 5->177|PF02737|1e-16|31.8|170/180|3HCDH_N| RP:PFM:REP 182->276|PF00725|3e-18|48.4|95/97|3HCDH| HM:PFM:NREP 2 HM:PFM:REP 5->177|PF02737|1.5e-32|33.5|170/180|3HCDH_N| HM:PFM:REP 182->278|PF00725|1.3e-26|48.5|97/97|3HCDH| GO:PFM:NREP 4 GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF02737|IPR006176| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02737|IPR006176| GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF00725|IPR006108| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00725|IPR006108| RP:SCP:NREP 2 RP:SCP:REP 2->177|1pgjA2|5e-08|10.8|167/178|c.2.1.6| RP:SCP:REP 182->278|1f0yA1|1e-27|37.1|97/99|a.100.1.3| HM:SCP:REP 1->180|1f0yA2|1.2e-31|34.3|178/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 182->279|1f0yA1|6.2e-27|46.9|98/99|a.100.1.3|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1705 OP:NHOMOORG 707 OP:PATTERN 11-1--4644444444-111121952231-2411---------------------------2331-11 14338--3--112152223-3222373333332323446621421212-21-313322--335-4417441-----1111--4-----------11---3-231242332--------------------------1--11---311--1-------------------1-------------22322---321222222223223222242221222344321-------43111111111111111211-1--1----1-----11---1-------1111---------------------------------------2-1112111111111211222111-1-3-4112-551416-14---1--1-4-15222-----236552222332223332232332-11611524553-2111232111224612-1233332125--------3---1221------------------------------1162-3644554444512333553433322474A57542344244433523243--2----12----------8332744-----------43314-11-22124311---------------------------22-2-1214311111111111113111111---11--------3222-223223333243-233322242322222322344412212222222222222222241222222--111111111111---1111112232--321111--------1---33323112324-44433442254563112----------222222222212221111111111-------1--------------1---------------------------------------- ----113-52--222233233333635111111111122222211111245545112224441--------------------------1-131113122222222-4438544315-121142221427M3-434-11-1-232-22--22-31422235325322535-39512111----222464222322111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 286-287| PSIPRED cccEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHccccccccccHHHHcccccHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHcccccEEEEEccccccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccEEcccccEEccccccccc //